KEGG   Mus musculus (house mouse): 74400
Entry
74400             CDS       T01002                                 
Symbol
Zfp819, 4930427I11Rik, 4933405K07Rik
Name
(RefSeq) zinc finger protein 819
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    74400 (Zfp819)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    74400 (Zfp819)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    74400 (Zfp819)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz Zn-ribbon_8 zf_UBZ zf-met zf-C2H2_6 Zn_ribbon_SprT C1_4 zf-C2HE DUF3268 HypA YjdM_Zn_Ribbon
Other DBs
NCBI-GeneID: 74400
NCBI-ProteinID: NP_001342060
MGI: 1921650
Ensembl: ENSMUSG00000055102
Position
7:43256559..43267703
AA seq 531 aa
MKKVKDSPMGKVDFPHQRCGQGEAEHDSHQMCVKAAFPNDVSRVITTGGSYCSIIEEPWQ
GGDPKTSDPQNHIPPSSSGAFFSQKTLITDGREAAGGSIPLGAHVISTQKRSLRCCPCEK
TLQPHLQADRDHQSSATEQPDGIVDSCQSFTQGLPTAVCPIHSTGEEARRGDQCASVPSP
QQPFMQHGTLSQDKPVEYTKYEKVFTAGSALCQQQTTNPLETHFICHICGKSFLQKSELS
FHPGTDRGETHHGCPGCRKSLPSTSSLQARHGTHTKEKPYRCPDCGKSFSYASHLKIHLR
IHTGERPYVCSDCGKAFSQKSVLTTHRRIHTGERPYTCNHCGKLFVYASDLKKHSRFHTG
EKPYECRDCGKLFNNKSHLPVHYRIHTGEKPYRCCDCGKSFRRKSHLKVHSRTHTGEKPY
ECPDCGRAFSHSSVLSTHQRIHTGERPYLCSDCGKAMSSKAQLNEHRRIHTGEKPYVCSE
CGKAFSCRSSLQAHRRTHSREKPFVCHTCGKGFLHKSQLSSHQQTHTGENP
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgaagaaagttaaggactcgccgatggggaaggttgatttcccacatcagaggtgtggt
caaggggaggcagagcatgactcacaccaaatgtgtgtgaaggctgcatttccaaatgat
gtatcaagagtaatcactacaggtggctcatattgttccattatcgaggaaccgtggcag
ggtggtgaccctaaaacttcagatccgcaaaaccacatcccaccctcgagttctggtgct
ttcttcagccagaaaacactaatcacagatggacgtgaagcagctgggggatccattcct
ttaggcgcccacgtcatttctacacaaaagagatctctgagatgttgcccgtgtgaaaag
acgttgcagcctcaccttcaagcagacagagaccatcaaagcagtgccacagagcagcct
gacggcattgttgactcttgtcagtccttcacacaaggccttcccactgctgtgtgtcca
attcacagcacaggagaggaagcacgcagaggggaccaatgtgcaagtgttcccagccct
cagcaaccatttatgcagcatggaactctttctcaggacaagccagttgaatataccaaa
tacgagaaggtcttcactgccgggtcagctttgtgtcagcagcaaacaactaaccctcta
gagacacattttatttgccacatatgtgggaaatccttccttcagaaatctgagttgagt
tttcatccaggaacagacagaggagagacacatcatggatgtcctggctgtcggaaatca
cttcccagtacatccagcctgcaggcacggcatggaactcacacaaaggagaaaccttac
agatgccctgactgtgggaagtcattcagttatgcatcccacctaaagatccatcttcga
atacacacaggtgagaggccttatgtgtgttctgactgtgggaaggcctttagccaaaag
tcagtcctcaccacgcatcggagaatccacactggggagaggccttacacatgtaaccac
tgcgggaaattgtttgtctatgcatcagatctgaagaaacacagtcggtttcacacaggg
gagaagccctatgagtgcagagattgtgggaagttattcaataataaatctcacctgcct
gtgcactatcgcattcacaccggtgagaaaccttacagatgctgcgactgtgggaagtcg
ttcaggagaaagtcccaccttaaagtgcatagccgaacacacactggtgagaagccttat
gaatgccctgactgcggaagggccttcagccacagttcagttctcagcacacatcagaga
attcacactggggagaggccttacctatgcagcgactgtgggaaggccatgtcttctaaa
gcccagctgaatgagcaccgaaggatccacacgggggagaaaccctatgtgtgcagcgag
tgtgggaaagctttcagttgccgatcttccttacaagcacatcgtagaactcacagtagg
gaaaagccgtttgtctgtcacacatgtgggaagggcttcctgcacaagtcacagttgtca
tctcaccaacaaactcacactggtgagaacccttag

DBGET integrated database retrieval system