KEGG   Mus musculus (house mouse): 74467
Entry
74467             CDS       T01002                                 
Symbol
Pus10, 2810013G11Rik, 4933435A13Rik, Ccdc139
Name
(RefSeq) pseudouridylate synthase 10
  KO
K07583  tRNA pseudouridine synthase 10 [EC:5.4.99.25]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    74467 (Pus10)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     74467 (Pus10)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    74467 (Pus10)
SSDB
Motif
Pfam: TPD
Other DBs
NCBI-GeneID: 74467
NCBI-ProteinID: NP_001028826
MGI: 1921717
Ensembl: ENSMUSG00000020280
UniProt: Q9D3U0
Position
11:23608588..23682876
AA seq 527 aa
MLPLTEENKHVAQLLFSSGTCPRCILRFCGVDLPAPYKHPSKELLNELQKFLEPEKPELI
LEAPNPPLKKIRLHEDGIDNLSEDGKEGVSVTEDESMAEKPSKLRVCNVCLGILQEFCEK
GFITKVCQKVEASGFEFTSVVLSVSFPPQLSVREHAAWLLVKQEMGKQSLSLGRNDVVQL
KEAYKWITHPLFSEELGVPTDGKSLFEVSVVFAHPETAEDCHFLGEVCRDCFKPAKNKQS
VFTRMAVLKALSKIKEEDFLGQFPCPPNSPKTVCTVLEVECTHGAVFVAGRYNKYSRNLP
QTPWIIDGERKMESSVEELISDHLLAVFRAESFNFSSSGREDVDVRTLGNGRPFAVELLN
PHRVHFTSQEMKELQQTINKSSDKIQVRDLQLVTREAIGHMKEGEEEKTKTYSALIWTNR
AIQKKDIGFLDDLKDLKIDQKTPLRVLHRRPLAVRTRAIHSMKTHYLDEHHFRLHLKTQA
GTYIKEFVHGDFGRTKPNLGSLMNVTADILELDVESVDVDWPPALDD
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgcttccactgactgaggagaacaagcacgtggcacagctgttgttcagttctggcacc
tgtccaagatgcatcttaagattctgtggtgtggatcttcccgcaccttacaaacaccca
tccaaggagttgctcaatgagctacaaaaatttctagaaccggaaaaacctgaattaatt
ttagaagctccaaacccaccattgaagaaaattcgtctacatgaagatgggattgataat
ttgagtgaagatggaaaggagggagtctctgttactgaagatgaaagcatggctgagaag
ccttcaaagctgagagtgtgcaatgtttgcttaggaattcttcaggaattctgtgagaag
gggtttattacgaaggtgtgccaaaaggttgaagcctctgggtttgaattcaccagcgtg
gttttatctgtctcctttccaccgcagctgtctgtaagagagcatgctgcatggttgctg
gtaaaacaggaaatgggaaagcagagtctgtccctgggaagaaatgatgtagtccagctg
aaagaagcctacaagtggataactcaccccctgttttcagaggagctgggcgttcccact
gatggaaagagcttgttcgaagtgagcgtggtctttgctcatccagaaacagctgaagat
tgccatttcctaggtgaagtttgccgagattgtttcaaaccagctaaaaataaacagtcg
gtatttaccagaatggcagttttgaaagctttgagtaagataaaagaagaagacttcctc
gggcaatttccttgtcctccaaactcaccgaagactgtatgcactgtccttgaagttgag
tgcactcatggtgctgtttttgtcgctggcagatataataaatactccaggaatctacca
caaactccttggataattgatggagaaaggaaaatggaatcttcggtggaagaattaatt
tcagatcatcttctggcagtattcagagcagagagttttaatttctcatcctcgggacga
gaagacgtagacgtgagaacattaggaaatggaaggccctttgcagttgaacttctgaat
cctcatcgagtgcatttcacctcacaagaaatgaaggagctccagcagacaattaataaa
tcatctgacaaaatccaagtccgtgacttgcagcttgtcaccagggaggcaatagggcat
atgaaggaaggtgaggaagaaaagactaagacctacagtgccttgatatggacgaataga
gctatccagaagaaggacattgggttcctggacgacttaaaggacttaaagattgaccag
aaaacacctctccgagtccttcaccgaaggcctttggctgtgagaactcgggccattcac
tctatgaagacacactacctggatgagcatcattttcgtctgcatttgaagacccaagct
ggaacctacattaaagaatttgtacatggagactttgggagaaccaaaccaaaccttggc
tctttgatgaacgtgactgcagacattcttgagctggatgtggagtctgtagatgttgac
tggccgcctgctctggatgactag

DBGET integrated database retrieval system