KEGG   Mus musculus (house mouse): 74570
Entry
74570             CDS       T01002                                 
Symbol
Zkscan1, 5930429A01Rik, 9130423L19Rik, 9230118B16Rik, AI646829, AI788588, C87323, KOX18, PHZ-37, ZNF139
Name
(RefSeq) zinc finger with KRAB and SCAN domains 1
  KO
K09229  KRAB and SCAN domains-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    74570 (Zkscan1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    74570 (Zkscan1)
SSDB
Motif
Pfam: zf-H2C2_2 SCAN zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_11 KRAB Zn-ribbon_8 C1_4 DUF5830 MRP-S23 Roughex GATA zinc_ribbon_15
Other DBs
NCBI-GeneID: 74570
NCBI-ProteinID: NP_598667
MGI: 1921820
Ensembl: ENSMUSG00000029729
UniProt: Q8BGS3
Position
5:138083312..138106084
AA seq 561 aa
MMTAESRETTGLSPQAAQEKDGIVIVKVEEEDEEDHMWGQDSSLQETPPPDPEVFRQRFR
RFCYQNTFGPREALNRLKELCHQWLRPEVNSKEQILELLVLEQFLSILPKELQVWLQEYR
PDSGEEAVTLLEDLELDLSGQQVPGQVHGPEMLARGVVPLDPVQESSSFDHHETAQSHFK
HSSRKPRLLSRALPATHVPAPHHEGNPRDQAMASALLTADSQAMVKIEDMAVSLILEEWG
CQNLARRNLNRDSRQMNLGNVFSQGSENRNGNESTSKAEVKEDSTSHGEIAGRFQKEFGE
KREQQGRVVERQQKNPEEKTGKEKKEPGPPTAKEKKPSTGERGPREKGKGLGRSFSLSAN
FNNTPEEAPSGAKTHRCDECGKCFTRSSSLIRHKIIHTGEKPYECNECGKAFSLNSNLVL
HQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQRI
HTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHARE
RTSEYSPASLDAFGAFLKSCV
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgatgactgctgagtcaagggaaaccacaggtctatccccacaggctgcacaggagaaa
gatggtatagttattgtgaaggtagaagaagaagatgaagaagaccacatgtgggggcag
gactctagcctgcaggagacaccaccacccgacccagaggtattccgccaacggttcagg
cgcttctgttaccagaacacttttgggcctcgagaagctttgaatcgactaaaggaactt
tgtcatcagtggctccgaccagaagtcaacagcaaggaacagatcttggagctgttggta
ctggagcagttcctgtccatcctgcccaaagagctgcaagtctggctgcaggagtaccgg
cctgacagtggggaagaggccgtgactcttctagaagacttggaacttgatctatcggga
cagcaggtcccaggtcaagttcatgggcctgagatgcttgccaggggtgtggtgcctctg
gatccagttcaggagtcctcaagctttgaccatcatgaaactgcccagtctcatttcaag
cattcatctaggaagcctcgtctcttatcccgagctctccctgccacccatgttcctgcc
cctcatcatgaggggaatcccagagaccaggcgatggcatctgcactattgaccgcagat
tcccaggcaatggtgaagatcgaggacatggccgtgtccctcatcctggaggaatgggga
tgtcagaacctggctcggaggaatctcaatagggacagcaggcagatgaatttggggaat
gtgttttcccagggctctgagaacaggaatgggaatgagtcaacctcaaaggctgaagtc
aaagaagattccacctcacatggggagatagcagggagattccagaaggaatttggagag
aaacgggaacagcagggcagagtagtcgaaaggcaacagaaaaatcctgaagagaaaact
ggcaaagaaaagaaagagcctgggccacctacagccaaggaaaaaaagcccagcacagga
gagcggggcccgcgggagaagggtaaaggtctggggagaagctttagcctgagcgcaaac
tttaataacaccccagaggaggctccgtcgggagcaaagactcacagatgcgatgagtgt
gggaaatgtttcacaagaagctcaagccttatccgccataaaatcatccacactggagag
aaaccctacgaatgtaacgagtgtggcaaagccttcagtctcaattcaaaccttgtcctt
catcagcgaatccacacgggagagaaacctcatgaatgtaacgagtgtggcaaagccttc
agccatagctcaaatctcatcctgcaccagcgcatccactctggagagaagccctatgaa
tgtaacgagtgtggcaaagccttcagccagagctcagacctcacgaagcaccagagaatc
catacaggagagaagccctatgaatgtagcgaatgtggaaaagctttcaaccgaaactca
taccttattttgcatcggagaattcacacccgagaaaagccctacaagtgcactaagtgt
ggcaaggccttcacccggagctcgaccctcacactgcaccacagaatccatgccagagag
agaacgtcagaatacagcccagcctctctggatgcctttggggcattcctgaaaagttgt
gtgtaa

DBGET integrated database retrieval system