KEGG   Mus musculus (house mouse): 74682
Entry
74682             CDS       T01002                                 
Symbol
Wdr35, 4930459M12Rik, 4931430C06, mKIAA1336
Name
(RefSeq) WD repeat domain 35
  KO
K19674  WD repeat-containing protein 35
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    74682 (Wdr35)
Cilium and associated proteins [BR:mmu03037]
 Primary cilia and associated proteins
  Intraflagellar transport (IFT) complex A
   74682 (Wdr35)
SSDB
Motif
Pfam: ANAPC4_WD40 WD40 Coatomer_WDAD Clathrin A2L_zn_ribbon eIF2A Cys_rich_CPCC Cmc1
Other DBs
NCBI-GeneID: 74682
NCBI-ProteinID: NP_766058
MGI: 1921932
Ensembl: ENSMUSG00000066643
Position
12:9023897..9078848
AA seq 1181 aa
MFFYLSKKIAVPNNVKLKCISWNKDQGFIACGGEDGLLKVLRLETQTDDSKLRGLAAPSN
LSMNQNLEGHSGAVQVVTWNEQYQKLTTSDQNGLIIVWMLYKGSWYEEMINNRNKSVVRS
MSWNADGQKICIVYEDGAVIVGSVDGNRIWGKDLKGIQLCHVTWSADSKILLFGMANGEI
HIYDNQGNFIMKMKLNCLVNVTGAISIAGIHWYHGTEGYVEPDCPCLAICFDNGRCQIMR
HENDQNPVLIDTGMYVVGIQWNHIGSVLAVAGSQKVVTQDKDINIVQFYTPFGEHLGTLK
VPGKQMCSLSWEGGGLKIALAVDSFIYFANIRPDYKWGYCSNTVVYAYTRPDRPEYCVVF
WDTKNSEKYVKYVKSLISITTCGDFCILATKADENHPQEENEMETFGATFVLVLCNSIGT
PLDPKYIDLVPLFVAMTKTHVIAASKEAFYTWQYRVAKKLTALEINQITRSRKEGRERIY
HVDDVPSGSVDGVFDYSKAIQGTRDPICAITASDKTLIVGRESGVIQRYSFPNVALIQKY
SLDCRACQLSLNCNSSRLAIIDIAGVLTFFDLDTRVTDSTGQQVVGELLKLERKDVWDMK
WAKDNPDLFAMMEKTRMYVFRNLDPEEPIQTSGYICNFEDLEIKSVLLDEILKDPEHPSK
DYIMNFEIRSLRDSRALIEKVGIEDASQFIEDNPHPRLWRLLAEAALQKLDLYTAQQAFV
RCKDYQGIKFVKLLGNLQSESMKQAEVIAYFGRFEDAERMYQDMDRRDLAIGLRMKLGDW
FRVLQLLKTGSGDADDSLLEQANNAIGEYFADRQKWQNAVQYYVKGRNQERLAECYYMLE
DYEGLETLANSLPENHKLLPEIAQMFVRVGMCEQAVSAFLKCNQPKAAVDTCVHLNQWNK
AVELAKSHSMKEIGSLLARYASHLLEKNKTLDAIELYRKASYFFDAAKLMYKIADEEAKK
RTKPLRVKKLYVLSALLIEQYHEQMKNAQRGKVKGKNSEATSALAGLLEEEVLSTTSRFT
DNAWRGAEAYHFFILAQRQLYEGYVDTALKTALHLRDYEDIIPSVEIYSLLALCACASRA
FGTCSKAFIKLESLETLSAEQKQQYEDLALEIFTKHTPKDNRKSELNSLLEGGEGKLPTC
IATGSPIIEYQFWVCKVCKHYVLAQEISNYNFCPLCHSSVE
NT seq 3546 nt   +upstreamnt  +downstreamnt
atgttcttctacctgagcaagaaaattgctgttcccaataatgtgaagctgaaatgtata
tcctggaacaaggaccaagggttcatagcatgtggcggtgaggatggattactgaaagtt
ttaagactcgagacacagacagatgactcaaagctgaggggtctagccgcccctagtaac
ctttccatgaaccaaaatcttgaaggtcatagtggtgctgttcaagttgtaacgtggaat
gaacagtatcagaagttgactaccagtgatcaaaatgggcttatcattgtctggatgctg
tataaaggctcttggtatgaggagatgatcaacaatcgcaacaagtctgtggttcgaagc
atgagctggaatgcggacggacagaagatctgcattgtgtacgaagatggagctgtgatc
gtcggctcagtagacgggaatcggatttgggggaaagacctgaagggaattcagctgtgc
catgtgacctggtctgcagatagtaaaatcctactttttggaatggcaaatggagaaata
cacatttatgataatcaaggaaattttataatgaaaatgaagctgaattgcttggtgaac
gtcactggagcgatcagtatcgctgggattcactggtaccatggcaccgaaggctacgtg
gagcccgattgcccttgcctggcaatttgctttgacaatgggagatgccaaataatgcgg
catgagaatgaccaaaacccggttttgatcgacacgggcatgtatgtggtaggcatccag
tggaaccacatcggcagtgtgttagctgtggccggctcccagaaggtagtcactcaggac
aaggacatcaacatcgtgcagttctacacaccgttcggtgagcatctgggtactttgaaa
gttccaggaaagcagatgtgttcgctgtcttgggaaggaggcggactgaagattgctcta
gctgttgactcctttatatattttgcaaatattcgacctgattataagtggggctactgt
tccaacacagtggtttatgcgtacaccagacccgatcgtcccgaatactgtgttgtgttc
tgggacacaaaaaacagtgagaaatacgttaaatatgtgaagagcctcatttctatcacc
acgtgtggagatttctgcattttggctacaaaagctgatgagaatcaccctcaggaggag
aatgaaatggagacatttggtgcaacgtttgtgcttgtcctttgcaattctattggcaca
cccttggaccctaaatacattgatcttgtaccattatttgttgcaatgaccaaaacccat
gtgatagcagcttcaaaagaagcattttatacctggcaatatcgtgtggcaaagaagctc
acagcactggaaattaatcagatcacacggtctcgaaaagaaggaagagaaagaatttat
cacgttgatgatgtcccttccggatctgtggatggggtgtttgattacagtaaagccatt
caaggtacaagggatccaatttgtgccattactgcatctgataagacattgattgtgggg
cgtgaatctggcgtcattcagaggtacagctttcctaatgttgctctgattcaaaagtat
tccctggattgccgtgcctgccagttatctctgaactgcaactccagtcgtcttgctatc
atcgacatcgctggagtcttgactttctttgacttggacactcgggtgaccgacagtaca
gggcagcaggtcgttggcgagttgctaaaactggagcgcaaagacgtctgggatatgaag
tgggccaaggacaatcctgatttgtttgcaatgatggagaagacgagaatgtatgttttc
agaaacttggatcctgaggaacccattcagacctctggatatatttgcaactttgaggat
ttggaaattaagtctgttctcttggatgagatactgaaggacccagagcaccctagcaag
gattacataatgaactttgagatccggtccctgcgagacagccgagcattgattgagaaa
gttggaattgaagatgcgtctcagttcatagaggacaacccacacccccgactttggcgc
ctgctggctgaagctgctctccagaagctggacctgtacaccgcacagcaagcgtttgtg
cgctgcaaggattaccaaggcatcaagtttgtgaagctcctgggcaatctgcagagcgag
tcaatgaagcaggctgaagttattgcctactttggcaggttcgaagatgccgaaaggatg
tatcaagatatggacagacgggacctcgctattggtctcagaatgaaattgggggactgg
ttcagagtactgcagctcctgaaaactggatctggtgatgcagacgacagtctccttgaa
caagctaacaatgccattggagagtactttgctgaccgacagaagtggcagaatgctgtg
caatattatgtaaaaggcaggaaccaggagcgcctggccgaatgctattatatgctagaa
gattatgaggggttagagactcttgccaattcacttccagaaaaccataagttgcttcca
gaaatagcccagatgtttgtgagagttggaatgtgtgagcaagctgtgagcgcattcttg
aagtgtaaccaaccaaaggcagcggtggacacctgtgtacacctgaaccaatggaacaaa
gccgtcgaactggctaaaagtcatagtatgaaggagattggatctctgttagctaggtac
gcgtcccatttactggagaagaacaagactctcgatgccattgaactctataggaaagcc
agctacttttttgatgcagctaaactgatgtataagattgcagatgaagaggcgaagaaa
aggaccaagcccctgcgtgtgaagaaactctacgtgctgtcggctctgctcatcgagcag
tatcacgagcagatgaaaaacgcccagcgcggcaaagttaaaggcaagaactcagaggcc
acttctgctttggctggcttgctagaagaggaggttctctctacaactagtcggttcaca
gataacgcctggagaggagcggaggcctaccatttctttatactcgcgcagcggcagctc
tacgagggctacgttgacactgcattgaagacagctcttcacctgagagactatgaagac
atcattccctcagttgagatctactctctgttagcactctgtgcgtgtgcaagcagagct
tttggtacctgttcaaaagcttttattaaactggaatctttagagacgctcagtgcagag
cagaagcagcaatatgaagacctggctctggaaatcttcaccaaacacacgccaaaagac
aacaggaagtctgaattaaacagccttcttgaaggcggggaaggcaaactgccgacctgt
atcgccactggcagcccaatcatcgagtatcagttctgggtgtgcaaagtctgcaagcac
tacgtcctcgcccaggagatcagcaactacaacttttgccctttatgccacagctcggta
gaataa

DBGET integrated database retrieval system