KEGG   Mus musculus (house mouse): 74754
Entry
74754             CDS       T01002                                 
Symbol
Dhcr24, 2310076D10Rik, 5830417J06Rik, mKIAA0018
Name
(RefSeq) 24-dehydrocholesterol reductase
  KO
K09828  Delta24-sterol reductase [EC:1.3.1.72 1.3.1.-]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00100  Steroid biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    74754 (Dhcr24)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.72  Delta24-sterol reductase
     74754 (Dhcr24)
SSDB
Motif
Pfam: FAD_binding_4
Other DBs
NCBI-GeneID: 74754
NCBI-ProteinID: NP_444502
MGI: 1922004
Ensembl: ENSMUSG00000034926
UniProt: Q8VCH6
Position
4:106418279..106446310
AA seq 516 aa
MEPAVSLAVCALLFLLWVRVKGLEFVLIHQRWVFVCLFLLPLSLIFDIYYYVRAWVVFKL
SSAPRLHEQRVRDIQKQVREWKEQGSKTFMCTGRPGWLTVSLRVGKYKKTHKNIMINLMD
ILEVDTKKQIVRVEPLVSMGQVTALLNSIGWTLPVLPELDDLTVGGLIMGTGIESSSHKY
GLFQHICTAYELILADGSFVRCTPSENSDLFYAVPWSCGTLGFLVAAEIRIIPAKKYVKL
RFEPVRGLEAICEKFTRESQRLENHFVEGLLYSLDEAVIMTGVMTDDVEPSKLNSIGSYY
KPWFFKHVENYLKTNREGLEYIPLRHYYHRHTRSIFWELQDIIPFGNNPIFRYLFGWMVP
PKISLLKLTQGETLRKLYEQHHVVQDMLVPMKCMSQALHTFQNDIHVYPIWLCPFILPSQ
PGLVHPKGDEAELYVDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE
FWEMFDGSLYHKLRKQLGCQDAFPEVYDKICKAARH
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggagcccgccgtgtcgctggccgtgtgcgcgctgctctttctgctctgggtgcgagtg
aaggggttggagttcgttctcatccaccagcgctgggtgttcgtgtgcctcttcttgctg
ccgctctcgctcatcttcgatatctactactacgtgcgcgcctgggtggtgttcaagctg
agcagtgcgccgcgcctgcacgagcagcgcgtgcgggacatccagaaacaggtccgggaa
tggaaggaacagggcagtaagaccttcatgtgcacggggcgcccaggctggctcactgtc
tcgctgcgagtcggaaagtacaagaagacccataagaacatcatgatcaacctgatggac
atcctggaggtggacaccaagaaacagattgttcgagtggagcccttggtgtctatgggt
caggtgacagctttgctgaactccattggctggaccctgcctgtgttgcctgagcttgat
gacctcacagtggggggcctgatcatgggcacaggcatcgagtcatcgtcccacaagtat
ggcctgttccaacacatttgcactgcctacgagctgatcctggcagacggcagctttgtg
cgctgcacaccgtctgaaaactcagacctgttctatgccgtgccctggtcctgtgggacc
ctgggcttcctggtggctgccgagatccggatcatcccggccaagaagtatgtcaagctg
cggtttgagcctgttcggggcctggaggccatctgtgaaaaattcacccgcgagtcccag
cggctggagaaccacttcgtggaagggttgctgtactccctggatgaggctgtcatcatg
acaggggtcatgacggacgacgtagagcccagcaagctgaatagcattggcagttactac
aagccctggttcttcaagcatgtggagaactacctgaagacaaaccgggagggcctcgaa
tacattcccctgagacactactaccaccgacacacgcgcagcatcttctgggagctccag
gacatcatccctttcggcaacaaccccatcttccgctacctcttcggctggatggtgcct
cccaagatctccctcctgaagctgacccagggcgagacgctacgcaagctgtacgagcag
caccacgtggtgcaggacatgctggtgcccatgaagtgcatgtcacaggccctgcatacc
ttccaaaatgacatccacgtctaccccatctggctgtgcccattcatcctgcccagccag
ccaggactagtgcatcccaagggagatgaagcagagctctacgtggacatcggggcatac
ggggagccacgtgtgaagcacttcgaggccaggtcctgcatgaggcagctggagaagttt
gtgcggagtgtgcacgggttccaaatgttatacgccgattgctatatgaaccgcgaggaa
ttctgggagatgttcgatggctccttgtaccacaagctgcgcaagcagctgggctgccag
gacgccttccctgaggtgtacgacaagatctgcaaggcggcaaggcactga

DBGET integrated database retrieval system