KEGG   Mus musculus (mouse): 75605
Entry
75605             CDS       T01002                                 

Gene name
Kdm5b, 2010009J12Rik, 2210016I17Rik, AW556288, D1Ertd202e, Jarid1b, PLU-1, PUT1, Plu1, RBBP2H1A, Rb-Bp2, mKIAA4034
Definition
(RefSeq) lysine (K)-specific demethylase 5B
  KO
K11446  [histone H3]-trimethyl-L-lysine4 demethylase [EC:1.14.11.67]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    75605 (Kdm5b)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    75605 (Kdm5b)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.67  [histone H3]-trimethyl-L-lysine4 demethylase
     75605 (Kdm5b)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     75605 (Kdm5b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    75605 (Kdm5b)
SSDB
Motif
Pfam: PLU-1 JmjC PHD ARID zf-C5HC2 JmjN PHD_2 zf-PHD-like FYVE_2
Other DBs
NCBI-GeneID: 75605
NCBI-ProteinID: NP_690855
MGI: 1922855
Ensembl: ENSMUSG00000042207
Vega: OTTMUSG00000017092
UniProt: Q80Y84
Structure
PDB: 
2EQY

Position
1 E4; 1 58.24 cM
AA seq 1544 aa
MEPATTLPPGPRPALPLGGPGPLGEFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTG
ICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKLNFLDQIAKYWELQGSTLKI
PHVERKILDLFQLNKLVAEEGGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILN
PYNLFLSGDSLRCLQKPNLTSDTKDKEYKPHDIPQRQSVQPAETCPPARRAKRMRAEAMN
IKIEPEEATEARTHNLRRRMGCTTPKWENEKEMKSTIKQEPTEKKDCELESEKEKPKSRA
KKTATAVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLVPPLHDVPKGDWRCPKCLAQE
CNKPQEAFGFEQAARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEED
VTVEYGADIASKEFGSGFPVRDGKIKISPEEEEYLDSGWNLNNMPVMEQSVLAHITADIC
GMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPE
LFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAV
NFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIE
DEKALRETVRKLGVIDSERMDFELLPDDERQCIKCKTTCFMSAISCSCKPGLLVCLHHVK
ELCSCPPYKYNLRYRYTLDDLYPMMNALKLRAESYNEWALNVNEALEAKINKKKSLVSFK
ALIEESEMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQLTVN
ELRQFVTQLYALPCVLSQTPLLKDLLNRVEDFQQQSQKLLSEEMPSAAELQELLDVSFEF
DVELPQLTEMRIRLEQARWLEEVQQACLDSSSLSLDDMRRLIDLGVGLAPYSAVEKAMAR
LQELLTVSEHWDDKAKSLLRARPRHSLSSLATAVKEMEEIPAYLPNGTVLKDSVQRARDW
VQDVDALQAGGRVPVLETLIELVARGRSIPVHLNSLPRLEMLVAEVHAWKECAAKTFLPE
NSTYSLLEVLCPRCDIGLLGLKRKQRKLKEPLPSGKKRSTKLESLSDLERALMESKETAA
AMATLGEARLREMEALQSLRFANEEKLLSPVQDLEMKVCLCQKTPATPMIQCELCRDAFH
TSCVAAPSISQSSRIWLCPHCRRSEKPPLEKILPLLASLQRIRVRLPEGDALRYMIERTV
NWQHRAQQLLSSGNLKLVQDQVGSGLLSSRWPASAGQASATDKVSQPPGTTSFSLPDDWD
NRTSYLHSPFSTGQSCLPLHGLSPEVNELLMEAQLLQVSLPEIQELYQTLLTKPSSVQQA
DRSSPVRSSSEKNDCLRGKRDAINSPERKLKRRPEREGLPSERWDRVKHMRTPQKKKIKL
SHPKDMDSFKLERERSYDLVRNAETHSLPSDTSYSEQEDSEDEDAICPAVSCLQPEGDEV
DWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRCTGKDAPSRK
NT seq 4635 nt   +upstreamnt  +downstreamnt
atggagccggccaccacgctgcccccaggcccgcgcccggcgctgcccctcgggggcccg
ggcccgctgggagagttcctgcctccccccgagtgtccggtcttcgagccgagctgggaa
gagttcgcggaccccttcgctttcatccacaagatccggcccatagccgagcagactggg
atctgtaaggtgcggccgccgccggattggcagccaccattcgcttgtgatgtcgataaa
cttcatttcaccccgcggatccagaggctgaatgagctggaggcccaaacacgtgtaaaa
ttgaatttcctggaccagattgcaaagtattgggagctacaaggaagtactctgaagatt
ccccacgtggagagaaagatcttagacttgttccagctaaataagttagtcgcagaagaa
ggtgggtttgcagttgtttgcaaggatagaaaatggaccaaaattgccaccaagatgggt
tttgctcctggtaaagctgtgggctcacatatcaggggacattatgagcgaatactcaat
ccatacaatttgttcctgtctggagacagtctgaggtgtcttcagaagcctaacctgacc
tccgacacaaaggacaaggagtacaaaccccatgatattccccagaggcagtctgtgcag
cccgcagaaacctgtcctccggcccgccgagcaaagcgcatgagagcagaggctatgaat
attaaaattgagccagaagaggcaacagaagccaggactcataatctgagacgccgaatg
ggttgcacaactccaaaatgggaaaatgagaaagaaatgaaaagcaccatcaagcaagag
cccactgagaagaaagactgcgagttagaaagtgagaaggagaagcccaagagccgggcc
aagaaaacggccactgcggtggacctgtatgtgtgcctcttatgtggaagtggcaatgac
gaggaccgactcctactgtgtgacggctgtgatgacagttaccacaccttctgcctggtt
ccccctctccatgacgttcccaagggagactggaggtgtcctaagtgtttggctcaagaa
tgtaataagccacaagaagcttttggttttgaacaagcagcaagggactatacacttcgt
acatttggagaaatggcagatgcattcaaatctgattacttcaacatgccagtccatatg
gttcccacagagctggtggagaaggagttttggcggctcgtaagcactattgaagaagac
gtcacggtggagtatggagctgatattgcttcaaaagagtttggcagtggctttcctgtt
cgagatgggaaaatcaagatttctcctgaggaagaggaatacctggatagtggctggaat
ttgaacaacatgccagtgatggagcagtctgtccttgctcatattactgctgatatatgt
ggcatgaaactcccctggttgtatgtgggcatgtgcttttcttcattctgttggcacatt
gaagaccactggagctattcaatcaactacctacactggggtgagccaaaaacctggtat
ggagttccaggctacgctgctgagcagctagaaaacgtgatgaagaagctcgctcctgag
ctctttgtgtcccagccggacctgctccaccagctggtgaccatcatgaaccccaacact
ctgatgactcatgaagtgcctgtttatcgaacgaatcagtgtgctggggagtttgtaatt
acgtttccaagagcctaccacagtggcttcaaccaaggttttaattttgccgaggctgtt
aacttctgcactgttgattggctgccattgggccgccagtgtgtggagcattatcgcttg
ctgcaccgttattgtgtcttttcccacgatgaaatgatatgcaaaatggcttctaaggct
gatgtattagacgttgtggtagcgtcaactgttcagaaggacatggccatcatgatcgag
gacgagaaagctttaagggaaactgttcggaaattgggagtaattgattctgaaagaatg
gattttgagctgttgccagatgatgagcggcagtgtataaaatgcaaaactacatgcttc
atgtctgccatctcctgctcttgtaaacctggcctacttgtttgcctacatcatgtgaaa
gaattgtgttcttgccccccgtataagtataacctgcggtatagatacactctggatgat
ctctatccaatgatgaatgcattaaagcttcgagcagagtcttacaatgaatgggcctta
aatgtgaatgaagccttggaagcaaagatcaataagaagaaaagtcttgtcagctttaaa
gctttgattgaagaatcagaaatgaaaaaattcccagacaatgatcttttgcgtcacctt
cgactagtcacgcaggatgcagaaaagtgtgcctctgttgcccagcagttgcttaatggc
aaaaggcaaacaaggtatcgatctggtggaggaaagtctcagaatcagctgacggtgaat
gaacttagacagtttgtgactcagctgtatgctctgccgtgcgtccttagtcagacaccg
ttgctaaaggatctcttgaatcgtgtggaagatttccaacagcaaagccaaaaactactg
tctgaggaaatgcctagcgctgccgagctacaggagttgctggatgtcagctttgaattt
gatgttgagcttccacagctcactgagatgcgcattcgcttagagcaggcccgctggctg
gaagaggttcagcaggcttgcctggactccagctccctttctttggatgatatgagacga
ctcatagacttaggggtggggctggctccatattctgctgtggagaaagctatggcccgc
ctgcaggagctgctaacagtgtcagaacactgggacgacaaagccaagagtctcctcaga
gcaagaccacggcattctttgagtagccttgctacagcagtcaaagagatggaggagatc
cccgcctacctgcccaatggtacagtcctgaaggattctgtgcaaagagccagagactgg
gttcaggatgtggatgcattgcaggcaggaggacgtgtgccagtgttagagacactcatt
gaacttgttgcaagaggccgatctatcccagtacatctcaattctttaccaagattggaa
atgttagtagctgaagttcatgcatggaaagaatgtgctgctaaaacattcttgcctgag
aattctacatattctctgttagaggttctttgccctcggtgtgacattggccttttgggg
ctgaaaaggaaacagagaaagttgaaggagcccttgccgagtggaaagaagagaagcacc
aagttagagagcctgagcgatctggagagggctctgatggagagcaaagagactgcggca
gctatggcaactcttggggaagctcgcctacgagagatggaagctttgcagtctctcaga
tttgccaatgaagagaaattgctgtcacctgtccaagacttagagatgaaagtctgcttg
tgtcagaagactccagccactcccatgattcagtgtgaactctgcagggatgctttccat
actagttgtgtggcagcacccagtatttcacaaagctcccgaatctggctttgtcctcac
tgtcggaggtcagagaagcctccattagagaaaattctgcctctgctggcctccctacag
cgtatacgagttcgtcttcctgaaggagatgcactccgatacatgattgaaagaaccgtg
aactggcaacatagagcccagcagctgctttcttcagggaatctaaaacttgtgcaagac
caagtgggttctggactgttgtctagcagatggccagcctcagcaggacaggcatcagca
acagacaaggtgtctcagcctcctggcacaacatccttttcattgcccgatgactgggac
aacagaacctcatatttacactctcccttctctactggacagagttgtctccccctccat
ggtttgagtccagaagtgaatgaattgctgatggaagcccagctgctccaggtatccctt
cctgaaattcaggagctttatcagactctacttactaagccaagctctgttcagcaagct
gaccgaagttcaccagttagatccagcagtgagaagaacgattgccttcgagggaaacga
gatgcaatcaacagtcctgagaggaaactgaaaaggcgcccagaaagagaaggccttcct
agcgagcggtgggatcgagttaaacacatgcggaccccccaaaagaagaaaatcaaactg
agtcaccccaaggacatggacagtttcaagttagaaagagagcgtagctatgacttagtg
cgtaatgctgaaactcattccctgccctcagacacatcctactccgaacaggaggactct
gaggatgaagatgccatctgtccagctgtgagctgcctgcagccagaaggagatgaggtg
gactgggtccagtgtgatggcagctgcaatcagtggtttcaccaggtctgtgttggtgtc
tctccagagatggcagagaaggaagactacatctgtgtgcgctgtactgggaaggacgca
ccaagccgaaagtaa

DBGET integrated database retrieval system