KEGG   Mus musculus (mouse): 76251
Entry
76251             CDS       T01002                                 

Gene name
Ercc6l2, 0610007P08Rik, 1700019D06Rik, 9330134C04Rik, Rad26l, Sr278
Definition
(RefSeq) excision repair cross-complementing rodent repair deficiency, complementation group 6 like 2
  KO
K20098  DNA excision repair protein ERCC-6-like 2 [EC:3.6.4.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    76251 (Ercc6l2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     76251 (Ercc6l2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Helicases
    76251 (Ercc6l2)
Motif
Pfam: SNF2_N Helicase_C ResIII DEAD ERCC3_RAD25_C VIGSSK HDA2-3 SWI2_SNF2 SEC-C DUF3510
Other DBs
NCBI-GeneID: 76251
NCBI-ProteinID: NP_001013626
MGI: 1923501
Ensembl: ENSMUSG00000021470
Vega: OTTMUSG00000026114
UniProt: Q9JIM3
Position
13; 13 B3
AA seq 1537 aa
MDISAPQSRADSRKDRWCPGERCLAPSLDNKKLCEASIKSITVDGNGKPFAVVLYPDFQE
KTIPLQRLQEVKSTKDYSRSLIFDDKDLEKPYFPDRKIPSLASAFQLSEDGDSIPYTINR
YLRDYQREGAQFLYRHYIEGRGCILGDDMGLGKTIQVISFLAAVLHKKGTREDIENNMPE
FLLKSMKKKPPSTAKKMFLIVAPLSVLYNWKDELDTWGYFRVTVLHGSKKDNELLRLKQR
KCEIALTTYETLRLCLEELNSLEWSAIIVDEAHRIKNPKARVTEVMKAVKCKVRIGLTGT
VLQNNMKELWCVMDWAVPGLLGSRIHFKKQFSDPVEHGQRHTATKRELATGRKAMHRLAK
KMSGWFLRRTKTLIKGQLPKKEDRMVYCSLTDFQKAVYQTVLETEDVALILTSSQPCTCG
SGQKRRKCCYKTNSRGDTVRTLCLSYLTVLQKVANHVALLQAASTSKHQETVIKRICDRV
FSRFPDFVQKSKDAAFETLSDPKYSGKMKVLQQLLNHFRKQRDKVLLFSFSTKLLDVLQQ
YCMASGLDYRRLDGSTKSEERLKIVKEFNSSQDVNICLVSTMAGGLGLNFVGANVVILFD
PTWNPANDLQAVDRAYRIGQCRDVKVLRLISLGTVEEIMYLRQVYKQQLHCVVVGSENAK
RYFEAVQGSKEHRGELFGVHNLFKLRSQGSCLTRDILEREGQVEAGIMTATTWLKGEPSA
QELETPRDPDCQEPTDVCELYSDISDEESVGHSLGKTDKHKFSDTSRTPGFPAQLTLLQC
GFSKLFEAKYKSDQDGDGNPVPSDGSSDEQPMCLSAEARQAARQKTWDSVCTSEHQKSDN
IQTPDEKCVSDKSEKTLEQNVSSESDDETKDHRTAGHHCMGQGDTESEDSDVIFPTQYPT
QRIPKNHIRFKLLLGESEDSEAENPVKVNHGDDRQNSGRGNGPVPNLLCLENMTSKSVRK
RKGTDDISDESDDIDMFPKSRIRKQRATTSLKFKRKKENKRKLDNSPVTAKEANQVCAAD
GDRSSQVIEDFSSSDDNLSLSHLSFTKLSHRAETVKDKISLSPKLPGPDKKNNTFISRKP
PSFLNEGVISQEQICNSMDKILDGVQEVAYIHSNQNVIGSSRAENHMSRWATRDVFELKQ
FSQLPANVAVCSSKTYKTQVKANIVSPTEKDQPPSDGGISSPLYVSHPVVQKKKDVYRTN
HTTFIIGETPRGIRRKQFEEMASYYKLPVKEFAEQVTRATSEERQKMLRDFYSLQHPEVK
EFFVNSASELIKSVHKKEERVRNKSKEKESLLKENPSNDSTLSCYDSTNKMSQVYNRKIC
EGKSVRSQNHVFHREDTFSSDAEINKSPVSFTEELHSERKDHTPKDTTTVFCPNSNSEAL
EAELGNSPGRQWDLTGACGSRNRPLFKLRNKRVENPGSENTPEDGLLGDTSILNDLFKSH
GEGPTQLPKNVLSGPVAKAKQKPKDFWDILNEQNDDSLSKLTDLAVIETLCTKAPSTSAS
KRKDELEASLWKANEKFLWKTLSSDVDDESISNTERE
NT seq 4614 nt   +upstreamnt  +downstreamnt
atggacatctccgccccgcagtcccgcgcagactcccgcaaagacaggtggtgtccggga
gaaagatgtcttgctccatctttggataacaaaaagctttgtgaagcaagcataaaatct
attactgtggatggaaatgggaaaccttttgcagttgtcctgtatccagactttcaagaa
aagacaatacctcttcaaagacttcaagaagtaaaatcaactaaagattactccagaagt
cttatatttgatgataaagatttagaaaaaccttatttcccagatcgaaaaattccatct
ttggctagtgcttttcaattatctgaagatggagactcaattccttatactattaatagg
tacttgcgagattaccaaagggagggggctcagttcctctacagacactacatagagggg
agagggtgtattcttggtgatgacatgggacttggaaaaacaatacaggttatttcattt
ctggctgcagttttgcataaaaagggaactcgtgaagatattgaaaataacatgccagag
tttttactaaaaagtatgaaaaagaagccgccttctacagctaaaaagatgttcttaata
gttgctcctctttctgtcctctacaactggaaggatgaattggatacctggggatatttc
agagttactgttttacacggtagcaaaaaagacaatgagctgcttcgtttaaagcagagg
aaatgtgaaattgctctgacgacctatgaaacactgcgcttgtgtctggaggagcttaac
agtttggaatggtcagctattattgtagatgaagctcatagaatcaagaatccaaaagcc
cgagttacagaagttatgaaggctgtgaagtgtaaggtccgcattggcctcactggtact
gtccttcagaacaacatgaaggagctgtggtgtgtcatggactgggctgtgccaggactt
ttaggtagcaggattcacttcaagaagcaattttctgacccagtggaacatggccagaga
cacacagcaacaaaaagagaacttgctactggccgaaaagccatgcacaggcttgcaaaa
aagatgtctggctggtttctcaggcgtaccaagactcttatcaagggccagctgcctaag
aaagaagaccggatggtgtattgttctttgacagacttccagaaagctgtctaccaaaca
gtgttagaaacagaagatgtggctctgatcctcacatcctctcagccttgtacctgtggc
agtggccagaagcgcagaaagtgttgttacaagaccaactcacggggtgacacagtgaga
accttgtgccttagttacctgactgtgcttcagaaagtagctaaccatgttgcactgctg
caggctgctagcacctccaaacatcaggaaacagttatcaagaggatatgtgatcgggta
ttttccagattcccagattttgtgcagaaaagcaaagatgcagcctttgagacactttct
gaccctaaatatagtgggaaaatgaaggtcctccagcagcttttgaatcattttaggaaa
caaagagataaggttcttctcttttccttttccaccaagctgctggatgtgctgcagcag
tactgtatggcctcgggcctcgattaccggcgactcgatggaagcacaaagtccgaggaa
aggctcaagattgtgaaggagtttaacagttcacaagatgtgaacatttgtcttgtctcc
acaatggctggtggactaggtctcaattttgttggggccaacgttgttatattatttgat
ccaacttggaatccagccaacgatcttcaagctgttgacagagcgtataggattggacag
tgtagagacgttaaagtgcttaggctaatatccttgggcacagtggaggagatcatgtac
ttacgacaagtctacaagcagcaacttcactgtgtggtggttggaagtgaaaatgccaag
cgatactttgaagcagtacaaggatcaaaagaacatcgaggagagctctttggtgtccac
aacctcttcaaactaaggtcccaagggtcatgtcttacgagagacatcctggagagggaa
ggccaagtggaagctggcatcatgacagccacaacatggttgaaaggggaaccttcagca
caagaactagaaacacctagagaccctgactgtcaagaacccacagatgtttgtgagctc
tacagcgacatcagtgatgaggagtcggtgggccattccctgggaaagactgataaacac
aaattctctgacaccagtagaactccaggcttcccagcacagctcactttgctacaatgt
ggattctctaagttgtttgaggcaaagtataagtcagaccaggatggcgatggcaaccct
gtccccagtgacggaagttctgatgagcagcccatgtgtctttctgcagaagccagacag
gctgctcgtcaaaagacttgggactctgtttgtacttcagaacatcagaaatcagataac
atccaaactccagatgaaaaatgtgtttctgataaaagtgaaaagactttagaacagaat
gtttcttctgaatctgatgatgagacaaaggatcaccgtacagctggacatcattgcatg
ggacagggtgacacagagtcagaagacagtgatgtcatctttcccacacagtatcccact
cagagaatccctaagaaccatatacgctttaagctgctgttaggtgaatctgaagattct
gaagcagaaaaccctgtgaaagtaaatcatggtgatgacagacagaacagtggcagaggg
aatggaccagttccaaatctcttgtgtctcgagaacatgacctcaaaatctgttaggaaa
agaaaaggtacagatgatattagcgatgagtctgatgacattgacatgttccccaagtca
agaataagaaagcaaagagccactacttccttgaaatttaagagaaaaaaggaaaacaaa
aggaaacttgataattctcctgtaacagcaaaggaagcaaatcaagtgtgtgcagctgat
ggagaccgtagctctcaggttattgaggatttttcatcctcagatgacaatttatctctc
agccacttgagtttcactaaactaagtcacagagcagaaactgtaaaagataaaatcagc
ttgtcccccaagctgcctggcccagataagaaaaataacacttttatatcaagaaaacca
ccaagctttctaaatgaaggagttatcagtcaagagcaaatatgcaactcaatggataaa
atattagatggtgttcaggaagtggcttatatccactcaaatcagaatgtgatcggctca
agcagagctgagaaccacatgagccgatgggcaacgcgtgatgtgtttgagttgaagcag
ttttcccagctccctgctaatgtagctgtttgcagttctaagacatacaaaactcaggtg
aaggcaaacatagtgtcacctacagagaaagatcaaccaccaagtgatggaggcatttcc
tctcctctgtacgtatcccaccctgtagtccagaaaaagaaagatgtatatcgtactaac
catactaccttcatcattggagaaacaccaagaggaatccgcagaaagcagtttgaagaa
atggcctcttactataagctgcctgtaaaggagtttgctgaacaagttactagggccaca
tctgaagagcgacagaaaatgctcagagacttctacagtcttcagcacccagaggtaaag
gagttctttgtgaattctgcttcagaattgataaaatctgtccacaagaaagaagagagg
gtgaggaataaatctaaagaaaaagaatctcttttaaaagaaaacccctcaaatgatagt
actttatcatgttatgattccaccaacaaaatgtctcaagtttacaacagaaaaatatgt
gaaggaaaatcagtcagatctcagaatcatgttttccatagagaagacacattttctagt
gatgcagagattaacaaatcacctgtcagctttactgaagagcttcacagtgagagaaag
gaccacacacccaaggataccacaacagtcttctgtccaaacagcaactctgaagccctg
gaggcagagctaggaaattccccaggacgtcagtgggacctcacaggagcatgcggttca
agaaacagaccacttttcaagttgagaaacaaaagggtagaaaacccagggtcagaaaac
actcctgaggatggcttacttggtgacacctctattcttaacgacctctttaaaagccac
ggggaaggtcccacacagctgccaaagaatgttctttcaggacctgtggcaaaagcaaag
cagaaaccaaaagatttctgggacatcttgaatgagcagaatgatgacagtctcagcaaa
ctcactgacttggcagtgatagagacgctgtgtaccaaagcacccagtacctcagcctcc
aaaaggaaagatgagctggaagcttccctttggaaagcaaacgagaagtttttgtggaag
acattaagctcagatgttgacgatgaaagcataagcaatacagagagagagtag

DBGET integrated database retrieval system