KEGG   Mus musculus (mouse): 76804
Entry
76804             CDS       T01002                                 

Gene name
Kdm4c, 2410141F18Rik, AA517467, Gasc1, Jmjd2c
Definition
(RefSeq) lysine (K)-specific demethylase 4C
  KO
K06709  [histone H3]-trimethyl-L-lysine9/36 demethylase [EC:1.14.11.66 1.14.11.69]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    76804 (Kdm4c)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.66  [histone H3]-trimethyl-L-lysine9 demethylase
     76804 (Kdm4c)
    1.14.11.69  [histone H3]-trimethyl-L-lysine36 demethylase
     76804 (Kdm4c)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    76804 (Kdm4c)
SSDB
Motif
Pfam: JmjC zf-HC5HC2H_2 Tudor_2 zf-HC5HC2H PHD_2 JmjN LBR_tudor PHD TUDOR_5
Other DBs
NCBI-GeneID: 76804
NCBI-ProteinID: NP_659036
MGI: 1924054
Ensembl: ENSMUSG00000028397
Vega: OTTMUSG00000000345
UniProt: Q8VCD7 A2BEG5
Position
4; 4 C3
AA seq 1054 aa
MEVVEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSSKYCTPRYLDYEDLE
RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVAKLCTCRNDMVKISMDIFVKKFQPDRYQIWKQGKDIYTIDHTKPTPESTPEVKTWL
QRKKKLRKPPKSLQGNKPLCKRPKPEEDEEFAEFSGEEGANPAMGPRHLKVTEKPEKALK
LGKLEESSAKEALDTRIQVDQSLLNDTKLSGKGCISSSVTAEIPPEDNRASAVISPSQLK
EGADCIPLSHGHQAGKESHLLKILKLESPKIPSPLPESNKVLTEGEENDEEGHGSNLEPG
EIPEALSEERNGLNIPKIIEGQPKTTKSWRHPLGKPPARSPMTLVKQQVASDEELPEVLS
IDEEVEETESWAKPLIHLWQTKSPNFMAEQEYNATVAKMEPNCAICTLLMPYYKPDSSKE
ENDSRWETAVNEVVQSGRKTKPIIPEMCFIYSEENVDYSPPNAFLEEDGTSLLISCAKCF
VRVHASCYGVPSHEVCDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNQWAHVICAVAV
PEVRFTNVPERTQIDVDRIPLQRLKLKCIFCRHRVKKVSGACIQCSYGRCPASFHVTCAH
AAGVLMEPDDWPYVVNITCFRHRVNSNAKSKTCEKAISVGQTVITKHRNTRYYSCRVIDV
TSQTFYEVMFDDGSFSRDTFPEDIVSRNCVKLGPPAEGEVIQVKWPDGKLYGAKYLGSNV
AYMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFSTASDMRFEDTFYGADVIQGERKR
QRVLSSRLKNEYVDDPVYRTFLKSSFQKKCQKRQ
NT seq 3165 nt   +upstreamnt  +downstreamnt
atggaggtggtggaggtggagagtcccctaaatcccagctgtaagataatgaccttcaga
ccttccatggaggagtttcgggagttcaacaaatacctcgcatacatggaatccaaagga
gcccatcgagcaggtcttgccaaggtgattcctcctaaggagtggaagccaagacagtgc
tatgatgatattgataatttgctcatcccagcaccaattcagcagatggtcacagggcag
tcgggactgttcacgcaatacaacatccagaagaaagccatgactgtgaaggagttcagg
cagctggctaacagcagcaaatactgtactccaagatacttggattatgaagatttggaa
cgcaaatactggaaaaacttaacttttgtggcacctatttatggagcagatataaatggg
agcatttatgatgagggtgtggatgaatggaatatagctcgcctaaatacagtcttggat
gtggttgaagaagagtgtggtatttctattgagggggtaaataccccttatctctatttt
ggaatgtggaaaacaacatttgcgtggcacacggaggacatggatctctacagtattaat
tatctccactttggggagcccaagtcttggtatgctatacctccggagcatggaaagcga
cttgaaagactagcccaaggcttcttccccagtagctcccaaggctgtgatgcatttctc
cggcacaagatgaccctcatttccccctcagtgctgaagaagtatggcattcccttcgac
aagatcacccaggaggctggagagtttatgatcacttttccttatggatatcatgctggt
tttaatcatggtttcaattgtgctgagtctacaaattttgctacagtcagatggattgac
tacggcaaggttgctaagttgtgcacttgtcggaatgacatggtgaagatatcaatggat
atatttgtgaagaaatttcagccagatagataccagatttggaaacaaggaaaggatata
tatactattgaccatacaaagcccactccagaatctactccagaagtaaaaacatggcta
cagaggaagaaaaaattaagaaagcctcccaagagcttacagggcaataagccactttgt
aaaaggcctaaacctgaagaagatgaggaatttgctgaatttagtggggaagagggtgca
aaccctgccatgggccctaggcacctcaaagtcactgaaaagccagaaaaagcattaaag
ctggggaaattagaagaatcttcagcaaaagaagctttggataccaggatacaagtggat
caaagcttactgaacgacaccaagctctcgggaaaaggttgcataagttcatcagtaaca
gctgaaattccaccagaagacaacagagccagtgctgtaatttcaccatctcagctgaag
gagggcgctgactgcataccactttctcatggccatcaagcaggcaaagagtcacatcta
cttaagattctaaagcttgaatctcccaagataccttcccccctgccagaaagtaataaa
gtattgacagagggagaagaaaatgatgaagagggccatggaagtaaccttgagcctggg
gaaatcccagaagctcttagtgaagagagaaatgggctcaacattcctaagataattgaa
ggacagccaaaaactactaagagttggcgccatccacttggtaagcctccggccagatcc
ccaatgacacttgtgaagcagcaggtagcgagtgatgaagaattgcctgaggttctaagc
attgacgaagaagttgaagaaacagagtcttgggcaaagcctctcatccacctttggcag
acaaagtctcctaactttatggctgaacaggagtacaatgcaactgttgcaaaaatggag
ccaaactgtgccatctgcactctgctcatgccgtactacaagcctgatagcagcaaagaa
gaaaatgattctagatgggagacagcagtaaatgaagtggttcaatctggaagaaagact
aagcccattattccagagatgtgttttatttatagtgaagaaaatgtagactattccccc
ccaaatgccttccttgaagaagatggaacaagtcttctgatttcctgtgccaagtgcttc
gtgcgggttcatgcaagttgttatggtgtcccttctcatgaagtctgtgatggatggctg
tgtgcccggtgcaagagaaatgcatggactgcagaatgctgtctctgcaatttgagggga
ggtgctctgaaacagactaagaacaatcagtgggctcatgtcatatgtgctgttgcagtt
ccagaagtgcgattcactaatgtcccagaacggacacaaatagatgtagacagaatacct
ttacagaggttaaaattgaaatgcatcttctgtagacaccgggttaaaaaggtttctgga
gcctgcatccagtgttcttatggccgctgcccagcttcattccatgttacgtgtgcccat
gctgctggagtgctcatggagcctgatgactggccttacgtggtaaacatcacatgcttc
agacatagagtcaactcaaacgcgaaatccaaaacttgtgagaaagccatttctgtgggt
cagacagtcatcacaaaacatcgaaacactcggtactacagctgcagagtgatagatgtg
acatctcaaaccttctatgaggtcatgtttgatgatggctccttcagcagagacacattt
cctgaagatattgtgagccgaaactgtgtgaagctgggccctcctgcggagggagaagtc
atccaagtcaaatggcctgatggtaaactctatggggcaaagtatcttggatcaaatgtt
gcctatatgtatcaggttgaatttgaagatggatcgcagattgcaatgaagagagaagac
atatacactttagatgaagagttacccaagagagtaaaggctcgtttttccacagcctcc
gacatgcgatttgaagacacattttatggagcagatgtaatccaaggggagaggaagagg
caaagagtgctaagctccaggctcaagaatgagtatgtggatgaccctgtgtatcgtact
ttcctgaagagttctttccagaagaagtgtcagaagagacagtag

DBGET integrated database retrieval system