KEGG   Mus musculus (house mouse): 77318
Entry
77318             CDS       T01002                                 
Symbol
Ankrd55, C030011J08Rik
Name
(RefSeq) ankyrin repeat domain 55
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_3 Ank_5
Other DBs
NCBI-GeneID: 77318
NCBI-ProteinID: NP_084174
MGI: 1924568
Ensembl: ENSMUSG00000049985
Position
13:112424985..112523391
AA seq 626 aa
MRQATMDFSTSSVFDQHKGDSSEEVDLAMVYQAASNGDVNSLTSVIREDPSILECCDSEG
CTPLMHAVSGRQVDTVKLLLKMGANINTQDAYGRTSLCLATYLGWLEGCVSLLRNGAKHN
IPDKNGRLPLHAATAEPDVRLLIVLLQQSSLSEINHQDTEGMTPLHWAAFHNRPQHTQML
LKKGADPTLVDKDFKTALHWAVQSGNRILCSIILSHRQGPSIINYDDESGKTCVHIAAAS
GFGDIINDLAKVPECNLQALDVDDRTPLHWAAASGKAECVQSLLDLGMDSNLRDINESTP
LAYALYCGHTACVRLLSREGRAEPARPLPSQNSQPQKKEGRFSMLNQIFCKNKKEEQKAH
QKDQSRARPKEEETSEVNDIIATFDSVVDTNCQGQPGDQVDMVVFKKRTSENSKYLLPEK
KSLARKGLPPIRTQSLPPITLGGHFLTASQGAVSHAGLNAGPQHTAQRSQKSRSEQDLLN
NRTGCPVSLENPWKGDTRQVFSCKAWTVSSSDKLLDRLFAGQPGHQELSGPPHLPHLHNP
SSGQALQHLSPNRPKIRDLPFTRNSLAPLPDQKFLSGEPLRTNRVLPAIPSQRGHDPSPA
GESQRGHDPPRAEESGGSSSPTHDEN
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgagacaggctaccatggatttcagcacctcttctgtgtttgatcagcacaaaggtgac
tcatctgaagaagtcgacctggcaatggtgtatcaggcagcatcgaatggagatgtcaac
tctctgacctccgtcattcgggaggatccgtccatcctggagtgttgtgacagtgaagga
tgcacgcccttgatgcacgcggtttcaggacgtcaagtggacacagtgaaattgctgcta
aagatgggtgccaacattaacacacaggatgcgtatggtcgcaccagtttatgcctggca
acctacctgggctggcttgaaggctgtgtgagtctgctcagaaacggtgccaagcacaac
atcccagataaaaatggccgcctacctctgcacgctgccactgcagagcctgatgtgagg
ctcctcatagtcctgctgcagcagtccagcctcagtgagatcaaccatcaagacacagag
gggatgacgccactccattgggcagctttccacaaccggcctcaacacacccaaatgctg
ttgaagaagggggcagaccccacccttgtggacaaggattttaaaacagccctccactgg
gcagtccagagtggaaatagaattctgtgctccatcattctgagccatcggcagggcccg
tccattatcaactacgacgacgagagtgggaagacgtgcgtccatatcgctgcagcttcc
ggtttcggagacatcatcaacgatttggcaaaggtccccgagtgtaacctgcaggctctg
gatgtggatgacaggacacccctgcactgggctgcagcttctggaaaggcagaatgtgtc
cagtcactgctggatctgggcatggacagcaacctaagggacattaacgagagcacgccc
ctggcctacgccttgtactgcggtcacacggcctgtgtccggctcctttcccgagaaggc
cgagcagagcctgctaggcctcttccctcccaaaacagccaaccccaaaagaaggaagga
cgattcagcatgctcaaccaaatcttctgcaaaaacaagaaagaggagcagaaagcccat
cagaaagaccagagcagggccagacctaaggaggaggagacctcggaagtcaatgacatc
atcgccacctttgacagtgtcgtggataccaactgccaaggtcagcctggtgaccaggtg
gacatggttgtctttaagaagaggacctcggagaattcaaagtatctcttgccagaaaag
aaatccctggcccgcaaggggctcccaccaatcagaacccagagtctcccacccatcacc
ctgggcggtcacttcctgacagcctcccagggagccgtgtcccatgctggcctgaacgct
ggtcctcagcatactgcccagcgttctcagaaaagtcgaagcgaacaggacttattaaat
aataggactggctgcccggtgtcactagagaatccttggaagggtgacaccaggcaggtg
ttctcctgcaaggcttggaccgtgtcttcttctgataagttactagacaggctgttcgct
ggccagcctggtcaccaggagctctctgggccaccacatcttcctcatctacataatccc
tcatcaggacaagctcttcagcatctctccccaaacagacctaaaatcagagatctcccc
ttcactcggaacagccttgcacctctgccagaccaaaaatttctatctggagaacccctg
agaacaaaccgggtgcttccagcaattccaagccagaggggacatgacccatcaccagct
ggagagagccagaggggacatgacccaccacgagctgaagagagcgggggttcctccagt
cccacccatgatgaaaactaa

DBGET integrated database retrieval system