KEGG   Mus musculus (mouse): 78752
Entry
78752             CDS       T01002                                 

Symbol
Csgalnact2, 4632415D10Rik, Galn, Galnact2
Name
(RefSeq) chondroitin sulfate N-acetylgalactosaminyltransferase 2
  KO
K00746  chondroitin sulfate N-acetylgalactosaminyltransferase 1/2 [EC:2.4.1.174 2.4.1.175]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
mmu01100  Metabolic pathways
Module
mmu_M00058  Glycosaminoglycan biosynthesis, chondroitin sulfate backbone
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    78752 (Csgalnact2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    78752 (Csgalnact2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.174  glucuronylgalactosylproteoglycan 4-beta-N-acetylgalactosaminyltransferase
     78752 (Csgalnact2)
    2.4.1.175  glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase
     78752 (Csgalnact2)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  O-Glycan
   78752 (Csgalnact2)
SSDB
Motif
Pfam: CHGN Glyco_transf_7C Glyco_tranf_2_2 KfrA_N SlyX Csm1_N Uso1_p115_C
Other DBs
NCBI-GeneID: 78752
NCBI-ProteinID: NP_084441
MGI: 1926002
Ensembl: ENSMUSG00000042042
Vega: OTTMUSG00000022841
UniProt: Q8C1F4
Position
6; 6 F1
AA seq 542 aa
MSRRGSILHSRTQWLLLGLALLFSLVLFMYLLECAPQTDGNASLPGVVRENYGKEYYQAL
LQEQEEHYQTRATSLKRQIAQLKQELQDMSEKMRALQERKKLGANGVGYPGNREQAPSDL
LEFLHSQIDRAEVSVGAKLPSEYGVVPFESFTLMKVFQLEMGLTRHPEEKPVRKDKRDEL
VEVIEAGVEVINNPDEDDAQEDEEGPLGEKLIFNENDFIEGYYRTERDKGTQYELFFKKA
DLMEYRHVTLFRPFGPLMKVKNELIDITRSVINIIVPLAERTEAFSQFMQNFRDVCIHQD
KRIHLTVVYFGKEGLSKVKSILESVSSESDFHNYTLVSLDEEFNRGRGLNVGARAWDKGE
VLMFFCDVDIYFSAEFLNSCRLNAEPGKKVFYPVVFSLYNPAIVYANQDVPPPVEQQLVH
KKDSGFWRDFGFGMTCQYQSDFLSVGGFDMEVKGWGGEDVHLYRKYLHGDLIVIRTPVPG
LFHLWHEKHCADELTPEQYRMCIQSKAMNEASHSHLGMMVFREEIEMHLRKQAYRTNSET
AG
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgtctagaagaggatcgattctgcacagccggacccagtggctgctgttgggccttgct
ttgctcttcagtttagtattatttatgtacctcctggaatgtgccccccagactgatgga
aatgcttctcttcctggtgttgttagagaaaattatggtaaagaatattaccaggccctc
ctgcaggagcaagaagaacattaccaaaccagggcaaccagtctgaaacgccagattgcc
cagctaaagcaagaattacaagatatgagtgagaagatgagagccttgcaagagagaaag
aagctaggggctaacggcgtaggctatcctggcaacagagagcaggcacccagtgacctc
ttagagtttcttcactcccagatcgatagagctgaagttagcgtgggggccaaactcccc
agtgagtatggagtcgttccctttgaaagttttactttaatgaaagtatttcagttggaa
atgggtctcactcgccatcctgaagaaaagccagttagaaaagacaaacgagacgaactg
gtagaagttattgaagctggcgtggaggtcattaataatcctgatgaagatgatgcacag
gaagatgaggagggtccccttggagagaaactgatatttaatgaaaatgacttcatagaa
ggctattatcgcactgagagagataaaggcacgcagtatgaactgttttttaagaaagca
gaccttatggagtacagacatgtgaccctcttccgcccttttggacctctcatgaaagtg
aagaatgaactgatcgacattacaagatcagttattaatatcattgtgccacttgcggag
aggacagaggcgttttcacagtttatgcagaacttcagagatgtttgtattcatcaagac
aagaggattcatctcaccgttgtgtattttgggaaagaaggactatctaaagtcaagtct
attctagaatctgtctcaagtgagtctgattttcacaattacaccttggtctcgttggac
gaagaatttaatcgtggacgaggactaaatgtgggtgcccgagcttgggacaagggagag
gtcttgatgtttttctgtgatgttgatatatatttctcagctgaattccttaacagctgc
cggttaaatgctgagccaggtaaaaaggtgttttaccctgtggtgttcagtctttacaac
cctgccattgtctatgccaaccaggacgtgccgccccctgtggagcagcagctggttcat
aaaaaggactctggtttttggagagactttggctttgggatgacctgtcaatatcaatcg
gatttcctgagtgtcggtggattcgacatggaagtaaaaggctggggtggagaagatgtt
catctttaccgaaaatacctacacggtgatcttattgtgattcggactccagttcccggt
cttttccacctctggcatgagaaacattgtgcagatgagctgacccctgagcagtaccga
atgtgcatccaatccaaagccatgaatgaggcctcccactctcacctgggaatgatggtt
ttcagggaggagatagagatgcatcttcgcaaacaggcatacagaacaaacagcgagact
gctgggtaa

DBGET integrated database retrieval system