KEGG   Mus musculus (mouse): 80292
Entry
80292             CDS       T01002                                 

Gene name
Zxdc, A930012H20, B930086F11Rik, BC003332
Definition
(RefSeq) ZXD family zinc finger C
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_8 zf-C2H2_aberr zf-C2H2_6
Other DBs
NCBI-GeneID: 80292
NCBI-ProteinID: NP_766590
MGI: 1933108
Ensembl: ENSMUSG00000034430
Vega: OTTMUSG00000023432
UniProt: Q8C8V1
Position
6 D1; 6
AA seq 858 aa
MDLPAVLAAPATRGDQHGGGPSRLRRGAGPSLGAGPGRRRLLLLRGPEDGGPGPRPEEAP
GPSPPPPEDGGDSFVVLLEVPRAADTHGQEEAEPDSGASPTEQVPAAAPGAALAGTVTIH
NQDLLVRFDRGVFTLAAAPAPAAPSLHPATTPGLEPSSAAASRRGPVAASAGSPAYRCPE
PQCALSFAKKHQLKVHLLTHGSLQGRRPFKCPLDGCGWAFTTSYKLKRHLQSHDKLRPFS
CPVGGCGKKFTTVYNLKAHMKGHEQESLFKCEVCAERFPTHAKLNSHQRSHFEPERPYKC
DFPGCEKTFITVSALFSHNRAHFREQELFSCSFPGCNKQYDKACRLKIHLRSHTGERPFI
CDSDSCGWTFTSMSKLLRHKRKHDDDRRFTCPVEGCGKSFTRAEHLKGHSITHLGTKPFE
CPVEGCCARFSARSSLYIHSKKHLQDVGTPKSRCPVSSCNRLFTSKHSMKAHVVRQHSRR
QDLVPQLEAPSSLTPSSELSSPGQSELTNIDLAALFSDTPANSSSSTAGSDEALNSGILT
IDVTSVSSSLGGNLPTNNNSLGPMDPLVLVAHGDMPPSLDSPLVLGTSATVLQPGSFSAD
DSQAMSTGAVGCLVALPVRNLNQDSPALTPSNNLTAPGTTPTSSDTTQETGSVPDLLVPI
KVEQDLSPVPDVVQGQKESHGPSQSVLSSSTERPGAQKDSELSAGTGSLYLESGGSARTD
YRAIQLVKKKKQKGTGSDEGASDSAHRKVKGGTINPPHVHSGQHSCFCGTLMVPSGGLTV
PAPAAGLQCVQIPVLQDDPSGEGGLPLGLSPQRSAFHPYFTVDLPVYVLQEVLPAPGGFA
GLETAQVPGSTINLRDLE
NT seq 2577 nt   +upstreamnt  +downstreamnt
atggacctcccggcggtgctggccgccccggccacgcgcggagaccaacatggcggtggc
ccgagccgacttcgccgcggcgcggggccgtccctcggtgccggtcccgggcgccgtcgc
ctgctgctgctgaggggcccggaagatggcgggcccgggccgcgtccagaggaggccccg
gggcccagcccgccgcccccggaggacggcggcgactccttcgtggtactgctggaagtg
ccgcgcgcggccgacacccatggtcaggaggaggccgagcccgattcgggcgcgagcccc
acggaacaggtcccggccgccgcccccggcgcagctctggcaggcacggtcaccatccac
aaccaggacctcctggtgcgcttcgaccgcggcgtcttcacgctggctgcggcgcccgcg
ccagccgccccgagcctgcatcccgcgaccaccccgggcctggagccctcgagcgctgct
gcgtcccgccgcgggccggtggccgctagcgctggctccccggcctaccgctgtccggag
ccgcagtgcgcgctgagcttcgccaagaagcaccagttgaaggtgcacctgctgacgcac
ggcagcctccagggccggcggcccttcaagtgcccgctggatggctgcggctgggccttc
accacctcctacaagctcaaacggcacctgcagtcgcatgacaagctgcgtccctttagc
tgcccggtgggcggctgcggcaagaagttcaccaccgtctacaacctcaaggcgcacatg
aagggccacgagcaggagagcttgttcaagtgcgaggtgtgcgccgagcgcttccccaca
cacgccaagctcaactcccaccagcgcagccacttcgagcccgagcggccttacaagtgt
gatttccccggctgtgagaagacgttcatcacagtgagtgccctgttttcccataatcga
gcccacttcagggagcaagagctcttttcctgctcctttcctgggtgcaataaacaatat
gacaaagcctgccgactgaaaattcacttgcgaagtcacacaggtgaaagaccatttatt
tgtgactcagacagttgtggctggaccttcaccagtatgtccaaacttctaagacacaaa
aggaaacatgatgatgaccggaggttcacttgccctgttgaaggttgtggcaagtcattc
actagagcagagcatctgaagggccacagtatcacccacctgggaacaaagccattcgaa
tgccctgtggaagggtgctgtgccaggttctcagctcgcagcagtctgtacattcattct
aagaaacatctgcaggacgtgggtactccgaaaagccgctgcccagtgtccagctgcaac
cgactcttcacctccaagcatagcatgaaggcacacgtggtgcggcagcacagccggcgc
caagatcttgtacctcagctggaagctccgagctctctcacacccagcagtgaactgagt
agcccaggccaaagtgagctcaccaacatagatctcgcagcacttttctctgacacacct
gctaatagcagcagttcaacagctgggtcggatgaagcactgaactctgggatcctcacc
attgatgtcacttctgtgagctcttctctgggagggaatctccctactaacaataactcc
ttaggaccaatggatccactcgttctagtggcccacggtgatatgcctccaagtttggac
agtcctcttgttcttgggacatcggccacggttctccaaccaggcagcttcagtgcagat
gattcacaggccatgagcacaggagcagtaggctgcctggtggctctgcctgtgaggaac
ttgaatcaagactctccagctttgacccccagcaataacttgacagcacctggtaccaca
ccaacttcttcagacaccacccaagaaactggcagtgtgccagatctgctggttccaata
aaggtggaacaagacttgtctcctgtcccagatgtggtccaggggcagaaagaaagccat
gggccatcccaatctgtgctgtccagctctacagagaggccaggggctcagaaggactca
gagctcagtgctggcacaggcagtctctacttggaaagtgggggctcagcaagaactgat
taccgagccattcaactagtcaagaaaaaaaagcagaaaggaactgggagcgatgaagga
gcctctgactctgctcacaggaaagtaaaaggtggcacgatcaaccctcctcatgtccac
tcaggccagcacagttgtttctgtggaactctcatggtacccagtggaggtctgacagtg
ccagcccctgcagctgggctgcagtgtgtccagatccctgttctgcaggatgacccctca
ggtgaaggaggcttaccactgggcctcagcccacagcgctctgccttccacccctacttc
accgtggatctgcctgtctacgtcctccaggaggtgcttccagcacctggaggttttgct
ggactggagactgcacaggtaccaggaagtactatcaacctgcgggaccttgagtga

DBGET integrated database retrieval system