KEGG   Mus musculus (mouse): 80707
Entry
80707             CDS       T01002                                 

Symbol
Wwox, 5330426P09Rik, 9030416C10Rik, WOX, WOX1
Name
(RefSeq) WW domain-containing oxidoreductase
  KO
K19329  WW domain-containing oxidoreductase
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    80707 (Wwox)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  WW domain-containing proteins
   80707 (Wwox)
SSDB
Motif
Pfam: adh_short WW adh_short_C2 KR PerB
Other DBs
NCBI-GeneID: 80707
NCBI-ProteinID: NP_062519
MGI: 1931237
Ensembl: ENSMUSG00000004637
Vega: OTTMUSG00000030624
UniProt: Q91WL8
Position
8; 8 E1
AA seq 414 aa
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLP
YGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGR
DFTGKVVLVTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILEEWHKAKVEAM
TLDLAVLRSVQHFAEAFKAKNVSLHVLVCNAGTFALPWGLTKDGLETTFQVNHLGHFYLV
QLLQDVLCRSSPARVIVVSSESHRFTDINDSSGKLDLSRLSPPRSDYWAMLAYNRSKLCN
ILFSNELHRRLSPRGVTSNAVHPGNMMYSAIHRNSWVYKLLFTLARPFTKSMQQGAATTV
YCAVAPELEGLGGMYFNNCCRCLPSEEAQSEETARALWELSERLIQDRLGSPSS
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggcagctctgcgctatgcgggcctggacgacacggacagtgaggatgagctgcctccg
ggctgggaggagagaaccaccaaggacggctgggtgtactacgccaatcacactgaggag
aagacccagtgggaacatccgaaaaccggcaagaggaaacgggtcgcaggagatttgccg
tatggatgggaacaggagactgacgagaacggacaagtgtttttcgttgaccacataaat
aaaagaactacctacttggatccaagattggcatttaccgtggacgataatccgacgaag
ccgaccaccagacagagatacgacgggagcaccaccgccatggagatcctgcagggccgg
gacttcacaggcaaggtggtcctggttactggagcaaattcgggaatagggttcgagact
gccaagtcctttgccctccatggcgcgcatgtgatcctggcctgtaggaacctgagcaga
gccagcgaggccgtgtcccgcatcctggaggagtggcacaaagccaaggtggaagcaatg
accctggacctggccgtgctccgtagcgtgcagcattttgccgaagcattcaaggccaag
aatgtgtctcttcacgtgcttgtgtgtaatgcagggacgtttgctctgccctggggcctc
acgaaggatggcctggagacaacctttcaggtgaaccacctgggacatttctaccttgtc
caactcctgcaggatgttctgtgccgctcatcccccgcccgtgtcatcgtggtctcttcc
gagtcccacagatttacagatattaatgactcctccgggaaacttgacctcagccgcctg
tctccaccgaggagcgactactgggccatgctggcttataacagatctaaactctgcaat
atcctcttctccaatgaactgcaccgtcgcctctccccgcgcggggtcacatccaacgca
gtgcaccctgggaacatgatgtactcagccatccatcgcaactcatgggtgtacaagctg
ctgttcaccttggccaggccgttcaccaagtccatgcaacagggagctgctaccactgtc
tactgtgcagtcgccccagagctggagggcctcggagggatgtatttcaacaactgctgc
cgttgcctgccatccgaggaggctcagagtgaagagacagctcgggccctgtgggaactc
agtgagaggctcatccaggaccgactgggtagtccatccagctaa

DBGET integrated database retrieval system