KEGG   Mus musculus (mouse): 80861
Entry
80861             CDS       T01002                                 

Gene name
Dhx58, B430001I08Rik, D11Lgp2e, LPG2, Lgp2, RLR-3
Definition
(RefSeq) DEXH (Asp-Glu-X-His) box polypeptide 58
  KO
K12649  ATP-dependent RNA helicase DHX58 [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    80861 (Dhx58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    80861 (Dhx58)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     80861 (Dhx58)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   80861 (Dhx58)
SSDB
Motif
Pfam: RIG-I_C-RD RIG-I_C ResIII Helicase_C DEAD SWI2_SNF2 AAA_19 AAA_22 SNF2_N zinc_ribbon_4 Terminase_6
Other DBs
NCBI-GeneID: 80861
NCBI-ProteinID: NP_084426
MGI: 1931560
Ensembl: ENSMUSG00000017830
Vega: OTTMUSG00000002055
UniProt: Q99J87
Position
11 D; 11 63.52 cM
AA seq 678 aa
MELRPYQWEVILPALEGKNIIIWLPTGAGKTRAAAFVAKRHLETVDRGKVVVLVNRVHLV
SQHAEEFRRMLDKHWTVTTLSGDMGSRAGFGLMARSHDLLICTAELLQLALNSSEEDEHV
ELREFSLIVVDECHHTHKDTVYNTILSRYLEQKLKKAEPLPQVLGLTASPGTGGATKLQG
AIDHILQLCANLDTCHIMSPKNCYSQLLMHNPKPCKQYDLCQRRAQDPFGDLIKKLMNQI
HQQLEMPDLKQQFGTQMYEQQVVQLCKDAAEAGLQEQRVYALHLRRYNDALFIHDTVRAR
DALDMLQDFYDRERTTKTQMVRAESWLLKLFDDHKNVLGQLAARGPENPKLEMLERILLK
QFGSPGHTRGIIFTRTRQTASSLLLWLRQQPCLQTVGIKPQMLIGAGNTSQSTHMTQKDQ
QEVIQEFRDGILSLLVATSVAEEGLDIAQCNVVVRYGLLTNEISMVQARGRARAGQSVYS
FLATEGSREMKRELTNEALEVLMEKAVAAVQKMDPDEFKAKIRDLQQASLVKRAARAAHR
EIQQGQFLPEHVQLLCINCMVAVGYGSDLRKVEGTHHVNVNPNFSVYYTTSQNPVVINKV
FKDWRPGGTIRCSNCGEVWGFQMIYKSVTLPVLKIGSILLETPRGKIQAKKWSRVPFSIP
VFDILQDCTQSLSELSLD
NT seq 2037 nt   +upstreamnt  +downstreamnt
atggagctgcgaccctaccagtgggaagtgatcttacctgctctggagggcaagaatatc
attatatggctgcccacgggtgctgggaagacccgggcagctgcctttgtagccaagagg
catctagagacggtagacagaggcaaggtggtggtactggtcaatagggtacacctggtg
agccagcacgccgaggagttcaggcgcatgctggataaacactggactgtaacaaccctg
agtggggacatgggatcccgagctggctttggcctgatggctcggagccacgacctgctc
atctgtacggcagagttgttacagttggcactcaacagctctgaggaggatgaacacgta
gagctcagagaattctcgctgattgtggtggacgagtgtcaccacacccacaaggacacc
gtctacaacaccatcttgagccggtacctagaacagaagctgaagaaggcagagcccctc
ccccaggtcctgggtctcacagcctccccaggcactggaggggccaccaagctccaaggg
gccattgatcacatcctacagctttgtgcgaatttggatacgtgccacatcatgtcgcca
aagaattgctactcccagctgctgatgcataacccaaagccctgcaagcagtatgacctc
tgccaaaggcgcgcacaggatccttttggggacttgataaaaaagcttatgaaccaaatc
caccaacaactagagatgcctgacttgaagcaacaatttggaacccagatgtatgagcag
caagtggtacagttgtgcaaggatgcggcagaggctggactccaggaacagcgggtgtat
gcgctgcatttgcggcgctacaatgatgcgctatttatccacgatactgtccgtgcccgg
gacgcccttgacatgttgcaagatttttacgacagagaacgcaccacaaaaacacagatg
gtgcgtgctgaaagctggctgctgaagctgtttgatgaccataaaaatgtgctgggccag
ctagcagctcggggtcctgagaacccgaagttggagatgctggaaaggatcttactgaag
cagtttgggagtcctggccacactcggggtatcatcttcaccagaacccgtcagactgct
tcctccctcctgctctggcttcggcagcagccttgcctacagactgtgggcatcaagccg
cagatgctgatcggagcagggaacacaagccagagcacacacatgacccagaaagaccag
caggaagtgatccaggagttcagggatggtatcctgagccttctagtggccacaagtgtg
gcagaggaggggctggatatcgctcagtgcaatgtggtggtgcgctatgggctcctgacc
aatgagatctccatggtccaggcccggggtcgtgctcgagctggtcagagtgtgtactcc
ttcctggctacagagggcagtcgggagatgaagcgggagctaaccaatgaggctctggag
gtgctgatggagaaggctgtggctgctgtacagaagatggaccctgatgagttcaaggcc
aagatccgggacttgcagcaagcatctctagttaagcgggcagcacgcgcggcccatcgg
gagatccagcaggggcagttcctaccggagcacgtgcaacttctctgcatcaactgtatg
gtggccgtgggctacgggagtgacctgcggaaagtggagggcacccaccacgtcaatgtg
aaccccaacttctcggtctactataccacctcccagaaccctgtggtcattaacaaggtc
tttaaggactggagacctggaggaaccatcaggtgcagtaactgtggggaggtctggggc
ttccagatgatctacaaatcagtgaccttgccagtgctcaaaatcggaagcatactactg
gaaacacctcgagggaagatccaggccaaaaagtggtcccgggtgcctttctccatacca
gtcttcgatatcctgcaggactgcacacaaagcctgtctgagctctccctggactga

DBGET integrated database retrieval system