KEGG   Mus musculus (house mouse): 81004
Entry
81004             CDS       T01002                                 
Symbol
Tbl1xr1, 8030499H02Rik, A630076E03Rik, AW539987, C21, C230089I12Rik, DC42, Ira1, TBLR1
Name
(RefSeq) transducin (beta)-like 1X-linked receptor 1
  KO
K04508  transducin (beta)-like 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    81004 (Tbl1xr1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 NBCH_WD40 eIF2A LisH Coatomer_WDAD WD40_like Nup160 PD40 K_channel_TID
Other DBs
NCBI-GeneID: 81004
NCBI-ProteinID: NP_109657
MGI: 2441730
Ensembl: ENSMUSG00000027630
UniProt: Q8BHJ5
Structure
Position
3:22130756..22270758
AA seq 514 aa
MSISSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGALVPPAALISIIQKGLQYV
EAEVSINEDGTLFDGRPIESLSLIDAVMPDVVQTRQQAYRDKLAQQHAAAAAAAAAATNQ
QGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPSNKAVVLRGHESEVFICAWNPV
SDLLASGSGDSTARIWNLSENSTSGPTQLVLRHCIREGGQDVPSNKDVTSLDWNSEGTLL
ATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEA
KQQFPFHSAPALDVDWQSNNTFASCSTDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPT
GNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASF
DSTVRLWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSY
RGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgagtataagcagtgatgaggtcaacttcttggtatataggtacttgcaagagtcagga
ttttctcattctgcgtttacctttggtatagagagccatataagtcagtccaacataaat
ggtgccctggttccacccgctgcactcatctctatcatccagaaaggcctgcagtatgta
gaggcagaagttagcataaatgaggatggcaccttatttgatggtcgacccatcgagtct
ctgtccctgatagatgctgttatgcccgatgtagtccaaacaagacaacaagcctacaga
gacaagcttgcacagcagcatgcagccgcagccgctgccgctgctgccgccactaaccag
caaggatctgcaaaaaatggagagaatacagcaaatggggaggagaatggagcacatacc
atcgcaaataatcacactgacatgatggaagtagatggggatgtggaaatcccttccaat
aaagcggttgtgcttcggggccatgaatctgaagttttcatctgtgcctggaaccctgtt
agtgatctcctggcatcagggtctggagactccacggcaagaatctggaacctcagtgag
aacagcacgagtggccctacgcagctcgtgcttagacactgcatacgggaaggagggcag
gacgtgcccagtaacaaggatgtcacgtctctagattggaatagtgaaggtacacttcta
gcaactgggtcatatgatggatttgccagaatatggactaaagatggtaatcttgccagc
accttggggcagcataaaggtcctatatttgcattaaaatggaataagaaaggaaatttc
atcctaagtgctggcgtagataagaccaccatcatttgggatgcgcatactggtgaagcc
aagcagcagtttcctttccattcagccccagcattggatgttgactggcagagcaacaac
acctttgcatcttgtagtacagatatgtgcattcacgtctgcaaattaggacaagacaga
cctatcaaaacattccagggacacacgaatgaagtaaatgctatcaaatgggacccaact
ggcaatctcctagcctcctgttcagatgacatgacattgaagatctggagtatgaagcaa
gataactgtgtccatgatttgcaagcacataataaagaaatttatactattaagtggagt
ccaacaggaccagggacaaataatccaaatgccaaccttatgctagcaagtgcatccttt
gattctacagttaggttatgggacgtagacagagggatttgcatccatactttgacaaaa
catcaagagcccgtgtacagtgtggcttttagtcctgatggcaggtatctggcaagtggt
tcttttgacaagtgtgtgcacatctggaacacacagacaggtgctctagttcacagttac
aggggaacaggtggaatttttgaagtttgctggaacgcagcaggagacaaagttggagcc
agtgcttcggacggttcagtttgtgtcttagaccttcggaaatag

DBGET integrated database retrieval system