KEGG   Mus musculus (house mouse): 84111
Entry
84111             CDS       T01002                                 
Symbol
Gpr87
Name
(RefSeq) G protein-coupled receptor 87
  KO
K08389  G protein-coupled receptor 87
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    84111 (Gpr87)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    84111 (Gpr87)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Saf_2TM Alg14 DUF4519
Other DBs
NCBI-GeneID: 84111
NCBI-ProteinID: NP_001289132
MGI: 1934133
Ensembl: ENSMUSG00000051431
UniProt: Q99MT7
Position
3:complement(59086325..59102583)
AA seq 358 aa
MGLNLTLTKLPGNELYSQASHTANSTSEGHGKNSTLHNKFDTIILPVLYLVIFVASILLN
GLAVWIFFHIRNKTSFIFYLKNIVVADLIMTLTFPFRIVRDAGFGPWYFEFILCRYTSVL
FYANMYTSIVFLGLISVDRYLKVVKPFGDSRMYSITFTKVLSVCVWVIMAILSLPNIILT
NGQPTKENIHDCMKLKSPLGAKWHMAVTYVDSCLFVAVLVILIGCYIAISRYIHKSSRQF
ISQSSRKRKHNQSIRVVVAVFFTCFLPYHLCRIPFTFSNLDRLLDESAHKILYYCKEMTL
FLSACNVCLDPIIYFFMCKSFSRRLFKKSNIRTRSESIRSLQSVRRSEVRIYYDYTDV
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggggctcaacttgacgcttacaaaattaccaggtaatgagctgtacagccaagcaagt
cacactgcaaacagcacaagtgagggacatgggaagaactctaccctgcacaacaaattt
gacaccatcatcctgccagtgctttacctagttatctttgtggcaagcatcctgctgaac
ggtctggccgtgtggatcttcttccacattcggaataaaaccagcttcatattttatctc
aaaaatatagtggtagctgacctcatcatgaccctgacattcccattccgaatagtccgt
gatgcaggattcggaccttggtacttcgagtttatcctctgcagatacacctcagttttg
ttctatgcaaacatgtatacatctatcgtgtttcttgggctgatcagtgttgatcggtat
ctaaaggtggtaaagccctttggtgactctcgcatgtacagcataaccttcaccaaagtt
ttatcagtttgtgtttgggtgatcatggctattctgtccttgccaaacatcatactgact
aatgggcagccaactaaggaaaatattcatgactgcatgaaactcaaaagtccgctggga
gccaagtggcatatggctgtcacctatgtggacagctgtttgtttgtggccgtgctggtg
atcctgattggatgctacatagccatctccagatacatccacaaatccagcaggcaattc
ataagccaatcgagccggaagcgaaagcacaaccagagcatccgcgtggtcgtggctgtg
ttttttacctgcttcctcccgtatcacttgtgcagaatcccctttaccttcagtaactta
gacaggcttctggatgaatcagcacataaaatcctctactattgcaaagaaatgacactt
ttcttgtctgcgtgcaacgtgtgcctggatccgataatttattttttcatgtgtaagtca
ttttcaagaaggttattcaagaaatcaaacataagaaccaggagcgaaagcatcaggtcg
ctgcaaagcgtccgaagatcagaagtgcgcatctattatgactacactgatgtgtaa

DBGET integrated database retrieval system