KEGG   Mus musculus (house mouse): 98417
Entry
98417             CDS       T01002                                 
Symbol
Cnih4, AI647760, AW050376, CNIH-4, D530030D03Rik, E430023H19Rik, HSPC163
Name
(RefSeq) cornichon family AMPA receptor auxiliary protein 4
  KO
K20368  protein cornichon
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    98417 (Cnih4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    98417 (Cnih4)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    98417 (Cnih4)
Transporters [BR:mmu02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   98417 (Cnih4)
SSDB
Motif
Pfam: Cornichon VP1_VP3 DUF2650
Other DBs
NCBI-GeneID: 98417
NCBI-ProteinID: NP_084407
MGI: 1925828
Ensembl: ENSMUSG00000062169
UniProt: Q9CX13
Position
1:180977437..180996559
AA seq 139 aa
MEAVVFLFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELVGHTIVTV
LMLVSLHWFIFLLNLPVATWNIYRFIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGF
YLLCFFMYLYSMILALIND
NT seq 420 nt   +upstreamnt  +downstreamnt
atggaggcggtggtgttcctcttctcgctcctcgactgttgcgcgctcatcttcctctcc
gtctacttcatcattacattgtctgatttagaatgtgattacattaacgccagatcatgt
tgctcaaaattaaacaagtgggtgatcccggagttggtcggccacaccattgtcactgtg
ctgatgcttgtctccctgcactggttcatcttccttctcaacttacctgtcgccacgtgg
aatatatataggttcattatggtgccaagtggcaacatgggagtatttgatccaacagaa
atacacaaccggggacagttaaagtcacacatgaaagaagccatgatcaagcttggtttc
tacctgctctgtttcttcatgtatctctatagtatgattctagctttgataaatgactga

DBGET integrated database retrieval system