KEGG   Mus musculus (mouse): 98999Help
Entry
98999             CDS       T01002                                 

Gene name
Znfx1, AI481105, Astx3
Definition
(RefSeq) zinc finger, NFX1-type containing 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: AAA_12 AAA_11 AAA_19 AAA_30 DUF2075 ResIII IstB_IS21 AAA_25 PhoH AAA_5 AAA DEAD
Motif
Other DBs
NCBI-GeneID: 98999
NCBI-ProteinID: NP_001028368
MGI: 2138982
Ensembl: ENSMUSG00000039501
Vega: OTTMUSG00000001138
UniProt: Q8R151
Position
2; 2 H3
AA seq 1909 aa AA seqDB search
MEDRRPHLEARPRNPPANHRGPMDGELPPRARNQTNNPAATNHAGRHLRASNHPAPFRQR
EERFRAMGRNPHQGRRNQEGHTSDEARDQRQSQNDTRRRNDDQEGRSHRPPWSSDTFQQW
HTPPQKPGEQPQQTKRLGYKFLESLLQKEPSEVAITLATSLGLKELLSHSSMKPSFLQLI
CQVLRKACSSRIDRQSILHVLGILNNSKFLRVCLPAYVVGMITEPSPDIRNQYPEHISNI
ISLLQDLVSVFPASSMQETSMLISLLPTSLNALRASGVDIEEETEKNLEKVQAIIKYLQE
KRRQGSLRVDTYTLVQAEAEGEVESYRAMPIYPTYNEVHLDEKPFLRPNIISGKYESTAV
YLDTHFRLLREDFVRPLREGILKLLQSFEDQCLRKRKFDDIRIYFDARIITPMCSASGIV
YKVQFDTKPLKLVRWQNSKRLLYGSLVCMSKDNFETFLFATVSNREHEDLCQGIVQLCFN
EQSQQLLADVQPSDSFLMVETTAYFEAYRHVLEGLQEVQEEDVPFQRNIVQCDSYVRNPR
YLLMGGRYDFTPLMENPSAMRKSLRGAEALRHPRINVFDFGQWPSKEALKLDDSQMEALQ
FALTKELAIIQGPPGTGKTYVGLKIVQALLTNKSVWQINTQTFPILVVCYTNHALDQFLE
GIYGCQKTSIVRVGGRSNSEILKQFTLRELRNKREFRRTLPMHLRRAYMSIVTEMKESEQ
KLQEGAQTLECTMHGVLREQHLEKYISAQHWESLMSGPVQDADWVCVQPSKHSMILEWLG
LGVGSFTQSASPAGPENTAQAEGEEEEEGEEEGSLIEIAEEADLIQADRVIEEEEVVRPR
RRKKEENGTDQELAKMLLAMRLDQEVPGTTAGPEQATEEWETQRGQKKKMKRRVKVELRK
LNTMTKAEANGIQDVWQLDLSSRWQLYRLWLQMYQADTRRRILSYERQYRTWAERMAELR
LQEDLHILKDAEVVGMTTTGAAKYRQILQQVEPRIVIVEEAAEVLEAHTIATLSKACQHL
ILIGDHQQLRPSANVYDLAKNFNLEVSLFERLVKVNIPFVRLNYQHRMRPEIARLLTPHI
YQDLENHPSVLKYEQIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAHFVVELCQYLLCQ
EYLPSQITILTTYTGQLFCLRKLMPVKTFAGIKVHVVDKYQGEENDIILLSLVRSNQEGK
VGFLQIPNRICVALSRAKKGMYCIGNMQMLAKVPLWSRIIHTLRENNQIGPSLRLCCQNH
PETHTLVSKASDFQKVPEGGCSRPCEFRLACGHVCTRACHPYDSSHKEFQCMKPCQKVLC
QDGHRCPNVCFQECQPCQVKVPKIILKCGHKQMVPCSMSESEFCCQEPCSKILRCGHRCS
HLCGEDCVRLCSERVTVELKCGHSQLVKCGNVEDIKYGLPVKCTTKCDTTLDCGHPCPGS
CHSCFEGRFHERCQQPCKRLLICSHKCQEPCTGECPPCQRTCQNRCVHSQCKKKCGELCS
PCVEPCVWRCQHYQCTKLCSEPCNRPPCYVPCTKLLACGHPCIGLCGEPCPKKCRVCQPD
EVTQIFFGFEDEPDARFVQLEDCSHIFEVQALDRFMNEQKDDEVAIKLKVCPICQVPIRK
NLRYGTSIKQRLEEIEIVKEKIQGSAGEISTSQEQLKALLKSKTLFHQLRPEEFLILQEK
LAQKNLSVKDLGLVENSIRFYDHLANLEGSLEKVHCGEQQSVRTRLEQVHEWLAKKRLSF
SSQELSDLQSEIQRLTYLVNLLMRCKMAEKVKGSIAEEVSSIRNILEKTSKFTQEDEQLV
QKKMDALKTTLPCSGLGISDEERVQIVTAMGVPRGHWFKCPNGHIYVITECGGAMQRSTC
PECQEVIGGENHTLERSNHLASEMDGAQHPAWSNTANNFMNFEEIHRMM
NT seq 5730 nt NT seq  +upstreamnt  +downstreamnt
atggaagacagaagacctcatctagaggccaggcccaggaatccgcctgccaaccacaga
ggtcctatggatggagaattgccaccaagagctagaaaccagaccaataacccagcagcc
accaaccatgctggaaggcatctgagggccagcaaccatcctgctcctttccgacagagg
gaagagagatttagggctatgggcaggaacccacatcagggaagaagaaaccaggaaggg
cataccagtgacgaagctagagaccagagacaaagccagaatgacaccaggaggaggaat
gacgaccaggaaggtaggagccacagaccaccatggtccagcgacactttccagcagtgg
cacaccccaccccagaagccaggagagcagccacagcagaccaagagactgggctacaag
ttcctggagagcctcctgcagaaggagccctctgaggtggccatcacgcttgccacaagc
ctagggctcaaggaactgctttctcattcctccatgaagcccagcttccttcagctgatc
tgccaagttctccggaaggcgtgcagctcccggatagaccgtcagagcatcctgcatgtg
ctgggcatcctgaacaactccaagttcctccgagtctgcctgccagcttacgtggtgggg
atgatcacggagcccagccccgacattcggaaccagtacccagaacacataagcaatatc
atctccctcctccaggacctcgtcagtgtcttccctgccagctctatgcaggaaacctcc
atgctcatctctctcctgccgacttctcttaatgctttgagagcctctggggttgacata
gaagaggagacagagaagaacctggaaaaggtacaggctatcattaagtatctgcaggaa
aagaggcgccagggcagtctgagagtagacacctacactctagtgcaggctgaggcggaa
ggggaggttgagagctaccgggccatgcccatctaccccacctacaacgaggtgcaccta
gatgagaagcccttccttcgccccaacatcatttccgggaaatacgagagcactgctgtc
tacctcgacactcacttccgcctcctgcgagaggattttgttaggccccttcgggaaggc
attttgaagcttctacaaagcttcgaggaccagtgtctgaggaagaggaagttcgatgac
atccgaatctactttgacgctaggatcatcaccccgatgtgctcagcctctggcatcgtg
tacaaagtgcagtttgacaccaagccgctcaagcttgttcgctggcagaattccaagcga
ctgctgtatgggtccttagtgtgcatgtccaaggacaacttcgagacgtttctttttgcc
accgtttcaaaccgagagcacgaagatctctgccaagggattgtccagctgtgcttcaac
gagcagagccagcagctgctggctgacgttcagccctctgactctttcctcatggtggag
acaacagcctactttgaggcttatcggcatgtcctggaagggctacaagaggtccaggaa
gaagatgtccccttccagaggaacattgtgcagtgtgactcctatgtgaggaacccgagg
tacttgctaatgggtggcagatatgacttcacccccctcatggagaatccctcagccatg
aggaagtctctgagaggtgctgaggctttgagacatcctaggattaatgtctttgacttt
ggccaatggccctccaaagaagccctgaagctggatgactcccagatggaagccttacag
ttcgccctcaccaaggagctggctatcattcaaggacctcctggaacaggcaagacttac
gtgggtctaaaaattgttcaggctcttctgaccaataagtctgtttggcaaattaatacc
cagacattccccatcttggtggtgtgttataccaatcatgctttggaccagtttctggaa
ggcatctacgggtgtcagaagaccagcattgtgcgagtgggcggaaggagcaacagtgaa
atcctgaagcagttcaccctgagggagctgaggaacaagcgggagttccgccgcaccctg
cccatgcacctgcggagggcctatatgagtattgtgacagagatgaaggagtcagagcaa
aaacttcaggaaggggcccagaccctggaatgcaccatgcacggtgtccttcgggagcag
cacctggagaagtacatctctgcccagcactgggaaagcctcatgagtgggcccgtgcag
gatgctgactgggtctgtgtgcagccctcgaagcactccatgattcttgaatggctgggg
cttggtgtgggctccttcactcagagtgcatctccagcaggacctgagaacacagcccag
gcagagggggaagaggaggaggaaggggaagaggagggttccctaatcgagattgcggaa
gaagccgacctgatccaagcggacagagtgattgaagaggaggaggtggtgagacctcga
agaagaaagaaggaagagaacggaaccgaccaggagctggctaaaatgctgttggccatg
agactggaccaggaagtgcctgggactacagctggaccagaacaagctacagaagagtgg
gagactcagcgtggccagaaaaagaagatgaagaggagagtgaaggtggagcttcgcaaa
ctgaataccatgaccaaggccgaggccaatgggatccaggacgtctggcagctggacctg
agctcccgctggcagctctataggctgtggctgcagatgtaccaagccgacactcgccgg
aggatcctcagctatgaacgccagtaccgcacatgggcagaaagaatggccgagctgaga
ctccaggaagaccttcacatcctcaaagatgccgaagttgtgggcatgacaaccacaggt
gctgccaagtaccgccagatccttcagcaagtggagcctcggatcgtcattgtagaagag
gctgctgaggtccttgaggcccacaccatcgccacactaagcaaagcttgccagcatctt
attctgattggggaccaccagcagctgcgccccagtgctaatgtgtatgatctggccaag
aacttcaaccttgaggtgtccctgtttgaacggctggtaaaagtgaacatcccctttgtc
cgtctgaattaccagcaccgcatgcgccctgaaatcgcccgccttttgaccccccacatt
taccaggatctggagaaccatccttctgttctcaagtatgagcagattaagggtgtctcc
tccaaccttttctttgtggagcacaactttcctgagcaggagatccaagaaggcaaaagt
caccagaaccagcatgaggcacactttgtggtggagctgtgccagtacctcctgtgccag
gagtacctgccctcccagatcaccatcctcaccacctacactgggcagctcttctgtttg
cgcaaactcatgcctgtcaagacgtttgctggcatcaaggtccatgtggtggacaagtac
caaggggaagagaatgacatcattctcctctcactggtgcggagcaaccaagagggcaag
gtgggcttcctgcagatccccaaccgcatctgcgtagccttgtcccgggccaagaagggg
atgtactgcattgggaacatgcagatgcttgccaaggtgcccttgtggagcaggatcatc
catacccttcgagagaacaaccagataggcccgtccctccgcctctgttgccagaaccac
cctgagacccacacccttgtatccaaagcttctgacttccagaaagtaccggaaggaggc
tgcagccggccctgtgagttccggttggcctgtggtcatgtgtgcacacgtgcctgccat
ccatatgactcctcccacaaggagttccagtgcatgaagccatgccagaaagtcctctgc
caggatgggcaccggtgcccaaatgtctgcttccaagagtgtcagccttgtcaggtgaaa
gtgcccaaaatcattctgaagtgtggtcacaaacagatggtcccttgttcaatgtcagag
tcagagttttgttgccaggagccttgctccaagatactaagatgtggtcacagatgcagc
catctctgtggtgaggattgtgtgcggctgtgttcagaaagggtcaccgtggaacttaaa
tgtgggcacagtcaactggttaagtgtggcaatgtggaagatataaaatatggtctgcca
gtcaagtgtaccaccaagtgtgacactactctagattgcggccatccctgcccaggctcc
tgtcacagctgttttgaagggcgcttccatgagcgctgtcaacagccatgtaagcgcctg
ctcatctgctcacacaagtgccaggagccctgcactggtgagtgcccaccctgccagcga
acatgtcagaaccgctgtgtccacagccagtgcaagaagaagtgtggggagctgtgcagc
ccctgcgtggagccctgcgtctggcgctgccagcactaccagtgcaccaaactctgctca
gagccctgcaaccggcccccatgctacgtgccttgtaccaagctgctggcttgtggccac
ccttgcatcggtctgtgtggggagccatgtcccaagaagtgccgtgtctgccaaccagat
gaagtcacccaaatcttttttggctttgaggatgagcctgatgcccgctttgtgcagcta
gaagactgcagccacatctttgaagtgcaagccttggaccgcttcatgaatgagcagaag
gatgatgaagttgccatcaagttgaaagtctgccccatctgtcaggtacccatccgcaaa
aacctgaggtatggaaccagcatcaaacagcggctggaagagatcgagattgtcaaggag
aagatccagggctctgcaggggagatttcaaccagccaggaacaacttaaggccctgctg
aagagcaagaccctcttccatcagctgcgtcctgaagaattcctaatacttcaagagaag
ctggcccagaaaaacctgtcagtgaaggacctgggcctggtggagaattctatccgcttc
tatgaccacttggccaacctggaggggtcactggagaaggtgcattgtggagaacagcag
agcgtgaggactcgacttgagcaggtccacgagtggctggccaagaagcgcctgagcttc
agcagccaggaactgagtgacctccagagtgaaatccagaggctcacctatttggtgaac
ctcctgatgcgctgcaagatggccgagaaggtgaaaggcagcatagcagaagaggtctcc
agcatccggaacattcttgaaaagacaagtaagttcacccaggaagatgaacagcttgtg
cagaaaaagatggatgctctgaaaaccacccttccctgctctggcttgggcatctcagat
gaggaacgagtgcagattgtcactgccatgggtgttcctcgtgggcattggttcaagtgc
cccaatggccacatctatgtaattactgagtgtgggggcgccatgcaaaggagtacctgt
cccgagtgtcaggaggtgatcggtggggagaatcacactctagagaggagcaaccacctg
gcctctgagatggatggagcccagcaccctgcctggtcgaacacagccaacaacttcatg
aactttgaggagatccacaggatgatgtag

DBGET integrated database retrieval system