KEGG   Mus musculus (mouse): 99334Help
Entry
99334             CDS       T01002                                 

Gene name
Zscan29, AW125441, Zfp690
Definition
(RefSeq) zinc finger SCAN domains 29
  KO
K09230  SCAN domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    99334 (Zscan29)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    99334 (Zscan29)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SCAN zf-H2C2_2 Myb_DNA-bind_4 zf-C2H2 zf-C2H2_4 Zn-ribbon_8 zf-C2H2_jaz zf-C2H2_11 MADF_DNA_bdg zf-C2H2_6 Myb_DNA-binding DUF3268 DZR zinc_ribbon_15
Motif
Other DBs
NCBI-GeneID: 99334
NCBI-ProteinID: NP_001277748
MGI: 2139317
Ensembl: ENSMUSG00000050619
Vega: OTTMUSG00000015972
UniProt: Q8BGW7 A2ARU5
Position
2; 2 E5
AA seq 834 aa AA seqDB search
MAKPTRRGNGTSSESLRQRFRRFHYQEVAGPREAFSQLWELCCRWLRPEVRTKEQIVELL
VLEQFLTVLPVEIQNWVQKQCPENGEEAVTLVEDLERESGRPGHSVTVSVKGQEMHSEKM
TPLKSSQELLSVLQESVEPQPKGVSKKERARRPALRLQEQMNPKENLRPFQRSGFPFPKP
NVVSRLDQGEPWISDLLSSKEKDVPKGNTGTSLLPSKRERTCWVEQGHWVFDDEKVVGVH
WGYKETRTLLAILSQTEFYEALRNCHRNSQVYGAVAGRLREYGFLRTLEQCRTKFKGLQK
SYRKVKSGHPPDTCPFFEEMEALMSAQVISLPINGLEEAASHSAQAGSDAETEKPGQRDW
QHEDGEEAIAERSDSDDPEATPQDPDNPPAPVLFRSPSGVHWGYEETKTYLAILSETQFY
EALQNCHRNSQLYGTVAERLWEYGFLRTPEQCRTKFKSLQTSYRKVKNGQALETCPFFEE
MDALVSAQVAAPPSDDQEKETVSCCLQRTSEAEPEKQDEDTEEDSDDEDDTEIPPEAVIT
RAPVLFQSPSGFEAGFENEENSKRDISEEVQLHRTLLARSERKISHHVNQSKASKNKCSS
ESQWEKTQREEQRQLAFPEKNIGKVLTYQRPGLEDRPYKYVKYGKSSGSNSHLRYPVSHE
VENPYKCADCGKSFSRSARLIRHQRIHTGEKPYKCLDCGKGFRDSSNFITHRRIHTGEKP
YQCDECGKRFNQSSSLIIHQRTHTGEKPYQCEECGKSFNNSSHFNAHRRIHTGERPHVCP
DCGKSFSKSSDLHAHHRTHTGKKPYGCHDCGKCFSKSSALSKHRETHTREKLLS
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacccactcggagaggaaatggcacaagctctgaaagcttacgacagcgcttc
agaagattccattaccaggaggtggctgggccccgggaggctttcagccaactatgggaa
ctttgctgtcggtggctaaggccggaggtgcggaccaaggagcagattgtagaattgttg
gtgctagagcaattcctgactgtgctacctgtggagatccagaactgggtacagaagcaa
tgtccagaaaatggagaggaggcggtgacactggtggaagatttagaaagagagtctgga
agacctggacattcggtcacagtctctgtgaaggggcaggaaatgcactcggagaagatg
acacccctgaaatcatcacaggagttattaagtgttctgcaggagtcagtggaaccccag
cccaagggtgtatccaagaaagagagggcaagaaggccagccctgagactacaggagcag
atgaacccaaaggagaatctcagaccttttcaaaggagcggatttccatttcctaaaccc
aatgtggtgtccaggttggatcaaggagagccatggatctcagatctgcttagctccaag
gagaaggatgtcccaaaaggcaacacaggaaccagtctattaccatccaagagagagaga
acctgctgggtggaacagggtcactgggtatttgatgatgagaaggtggtgggtgtgcac
tggggctacaaagagactagaacactccttgcaattctcagtcagactgaattttacgaa
gcgctccgaaactgtcacaggaacagccaagtgtatggggctgtagctgggaggcttcgt
gaatatggtttcctccggactctggaacagtgtcggaccaagttcaaaggccttcagaag
agctacaggaaggtcaagagtggtcatccacccgacacctgccccttctttgaagagatg
gaagccctgatgagtgcccaggtcatttcattgcccattaatggcctggaagaggcagcc
tcccattctgcccaggcaggcagtgatgctgagacggagaagccagggcagagggactgg
cagcatgaagatggagaggaggctatagctgaaaggtcagacagtgatgacccggaggca
accccccaggaccctgacaacccacctgcacctgtcctgttccgaagcccaagtggtgta
cactggggctatgaagaaaccaagacttaccttgcaattctcagtgagactcagttctac
gaagccctccaaaactgtcaccgcaacagccagttatatggaacagttgctgagagactg
tgggaatatggcttccttagaaccccagagcaatgtcgtaccaaatttaaaagcctacaa
accagctatcggaaagtcaagaatggccaagcactagaaacctgccccttctttgaagaa
atggatgctttagtgagtgcccaagttgctgccccacctagtgatgaccaggagaaagaa
acagtttcttgttgcctccagagaaccagtgaggctgaacctgagaagcaagatgaggac
acagaagaagattcagatgatgaagatgatactgaaatacctccagaggctgttataacc
cgtgccccagtcttattccagagccccagtggtttcgaggctggatttgaaaatgaagaa
aattcaaaacgggatatttctgaggaagtacagctgcatagaacattacttgcaaggtct
gaaaggaaaatttcccatcatgttaatcaaagtaaagcgagtaagaataaatgctcatca
gaaagccagtgggaaaagactcaaagagaggaacaaagacaactagcattcccagagaag
aatataggtaaagtcctgacctatcagaggccaggcttggaagacagaccttataaatat
gtcaagtatggcaaaagctctggttcaaactcccatctcaggtatccggtctcccatgag
gtagagaacccatataaatgtgctgactgtgggaaaagcttcagtcggagtgcacgcctc
atcagacaccaaagaatccacaccggagaaaaaccgtataagtgtcttgactgtgggaaa
ggtttccgtgacagttccaatttcattacccatcggagaatccacacaggagaaaaaccg
tatcagtgtgatgaatgtggaaaacgcttcaaccagagctcaagccttataattcaccag
agaacccacacaggagaaaagccttatcagtgtgaagagtgtgggaaaagcttcaataac
agttctcatttcaatgcacacaggaggatacacacaggagagagaccccatgtgtgtcct
gactgtggtaagagttttagtaagagttctgacttgcatgcacatcacagaacccacaca
ggaaagaaaccttatgggtgccatgactgtggcaagtgcttcagtaagagctctgccctt
agtaaacaccgagagactcatactcgagaaaagctgctgtcatag

DBGET integrated database retrieval system