KEGG   Mus musculus (mouse): 99571Help
Entry
99571             CDS       T01002                                 

Gene name
Fgg, 3010002H13Rik, AI256424
Definition
(RefSeq) fibrinogen gamma chain
  KO
K03905  fibrinogen gamma chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu04611  Platelet activation
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    99571 (Fgg)
   04611 Platelet activation
    99571 (Fgg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    99571 (Fgg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    99571 (Fgg)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    99571 (Fgg)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   99571 (Fgg)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   99571 (Fgg)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   99571 (Fgg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C Fib_alpha Spc29 COG5
Motif
Other DBs
NCBI-GeneID: 99571
NCBI-ProteinID: NP_598623
MGI: 95526
Ensembl: ENSMUSG00000033860
Vega: OTTMUSG00000051802
UniProt: Q8VCM7 Q3UEM7
Position
3 E3; 3 36.94 cM
AA seq 436 aa AA seqDB search
MSWSLQPPSFLLCCLLLLFSPTGLAYVATRDNCCILDERFGSFCPTTCGIADFLSSYQTD
VDNDLRTLEDILFRAENRTTEAKELIKAIQVYYNPDQPPKPGMIDSATQKSKKMVEEIVK
YEALLLTHETSIRYLQEIYNSNNQKITNLKQKVAQLEAQCQEPCKDSVQIHDTTGKDCQE
IANKGAKESGLYFIRPLKAKQQFLVYCEIDGSGNGWTVLQKRIDGSLDFKKNWIQYKEGF
GHLSPTGTTEFWLGNEKIHLISMQSTIPYALRIQLKDWNGRTSTADYAMFRVGPESDKYR
LTYAYFIGGDAGDAFDGYDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWW
MNKCHAGHLNGVYHQGGTYSKSSTTNGFDDGIIWATWKSRWYSMKETTMKIIPFNRLSIG
EGQQHHMGGSKQAGDV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagttggtctttgcagcccccgagtttccttctttgctgcctgcttttactgttctct
ccaacgggcctggcatatgtggctaccagagataactgttgcatcctagatgagagattc
ggtagtttctgcccaaccacctgtggtatcgcagatttcctgtcttcttaccaaaccgac
gtggacaatgatctccgaacgctggaagacatcttattccgggctgaaaacagaaccaca
gaagccaaagaactgatcaaagcaattcaggtttactacaacccagaccaacccccaaag
ccaggtatgatagacagtgccactcagaagtctaagaagatggtagaagaaattgtgaaa
tacgaagcgctgctgttaacccacgagacaagcattcggtatttacaggaaatctataat
tcaaataaccagaagatcacaaacctaaaacagaaggtagcccagcttgaagcccagtgc
caggagccttgcaaggactctgtgcaaatccatgacacaactggaaaagattgtcaggaa
attgccaacaagggcgccaaagaaagtggactttacttcattcgacctttgaaagctaag
cagcagttcttagtgtactgtgaaatcgacggatctggaaatggttggaccgtattgcag
aagaggattgatggcagtttggatttcaagaagaactggattcagtataaagaaggattt
ggacacctgtcgcctactggcaccacagagttttggctgggaaatgagaagattcatttg
ataagcatgcagtccacaattccatatgcactgagaatacagctcaaagactggaatggc
agaaccagcactgcggactatgccatgttcagggtgggtcccgagtctgacaaataccgc
ctgacctatgcctacttcattggtggagatgccggggatgccttcgacggctacgatttc
ggcgatgaccccagtgacaagtttttcacatcccacaacggcatgcagttcagtacctgg
gacaacgacaacgataagtttgaaggcaactgtgcggaacaggatggatccggctggtgg
atgaacaaatgtcacgcaggccacctcaatggagtttatcaccaaggtggtacttactca
aaatcatctactactaatggtttcgacgacggcattatttgggcgacctggaaaagccgc
tggtattctatgaaggaaaccaccatgaagataattcccttcaacagactctccatcgga
gaaggacagcagcatcacatggggggatccaaacaggctggagacgtttaa

DBGET integrated database retrieval system