KEGG   Mycobacterium paragordonae: C0J29_17815
Entry
C0J29_17815       CDS       T06847                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_17815
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    C0J29_17815
Enzymes [BR:mpag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     C0J29_17815
SSDB
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Peptidase_S9 DLH
Other DBs
NCBI-ProteinID: AYE96378
UniProt: A0A386U7U3
Position
complement(3922234..3923199)
AA seq 321 aa
MTNTDAADRRPSLASHFVAMTSRNTLRPLSQLIPSSAHGLAVMDRVLRMALVGSRPRRSV
AVRTIDTEFAGNQIRGDWITSPAVDPHAVPLLYIHGGAYSMCSPATHRGLLGELASASGR
PIFAVRYRLAPRYPFPAAADDALNAYRWLVTGQPSASGERGVAVAGDSAGGQLTMATALG
ARSDGLPLPDSMLLMSPVLDLTCELARARELRRRDPFASARSAARALDLYVAGADHRNER
ISVLDADLRSMPPILIQVGGREMLIDDSRHLADRLRSAGSSVEIQVYRGQIHVFQAMFRI
LPEAREAIHRAGNFLKASAHR
NT seq 966 nt   +upstreamnt  +downstreamnt
gtgaccaacactgatgcggcggaccggcgccccagtcttgcaagtcatttcgtggcaatg
acttcgcgaaacacactgcgtccgctgtcgcaactcatcccgtcgagcgcccacggcctc
gcggtgatggatcgcgtactccggatggcgcttgtgggatcgcggccccgccgaagcgtg
gcggttcgcacaatagataccgagttcgccgggaatcagatacgcggggattggatcact
tctcctgcagtcgatccacacgcggttccgttgctctacattcatggcggcgcctactcc
atgtgctcaccggctacccaccgcggcctgctcggtgaacttgcctccgcgagcggtcgg
cccatctttgcggtgaggtatcggctagctccacgctatccctttcccgctgccgccgac
gatgcactgaacgcataccgctggctcgtcacagggcagccttcggcttccggcgaacgc
ggtgttgcggtggccggggactcggcgggcggccagctcacgatggccaccgcccttggc
gcacgtagtgacggactgccgctgccggattcgatgcttctcatgtctccggtcctggat
ctgacatgtgaactcgcgagggcacgcgaacttcgccgccgtgatcctttcgcctctgct
cggtccgcggcccgcgctcttgacctgtacgtggctggtgcagatcaccgcaatgagcga
atcagcgtgctcgacgcagacctcaggtccatgccaccgatcctgattcaggtaggcgga
agagaaatgttgatcgatgactcgaggcatcttgccgaccgcctccgatcggccggatca
agcgttgagatacaggtgtaccggggacagatccacgtgttccaagccatgttccgaatc
ctgcccgaggctcgtgaggcgatccaccgcgctggaaacttcctgaaagcttcggcccac
cggtga

DBGET integrated database retrieval system