KEGG   Mycolicibacterium smegmatis MC2 155: MSMEI_1405Help
Entry
MSMEI_1405        CDS       T02191                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
msg  Mycolicibacterium smegmatis MC2 155
Pathway
msg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:msg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MSMEI_1405 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:msg03011]
    MSMEI_1405 (rplV)
Ribosome [BR:msg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MSMEI_1405 (rplV)
  Bacteria
    MSMEI_1405 (rplV)
  Archaea
    MSMEI_1405 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AFP37878
UniProt: A0QSD6
Structure
PDB: 

Position
1541972..1542433
Genome map
AA seq 153 aa AA seqDB search
MSTVTEFPSATAKARYVRVSATKARRVIDLVRGKSVEEALDILRWAPQAASEPVAKVIAS
AAANAQNNEGLDPSTLVVATVYADEGPTAKRIRPRAQGRAFRIRKRTSHITVIVESRPPK
QKGASAASARSRRAQGSKAAATKKSAETKEGSE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgtcactgaatttccatccgcgacggcgaaggcacgctacgtgcgtgtctcg
gccaccaaggcccgccgcgtcatcgacctggtccgcggcaagagcgtcgaggaagccctc
gacatcctgcggtgggcgccgcaggccgccagcgaaccggtcgccaaggtgatcgcgagc
gctgccgccaacgcgcagaacaacgaggggctggacccgtccaccctggtggtcgccacc
gtctacgccgacgagggcccgaccgccaagcgcatccgtccgcgtgcccagggccgtgcc
ttccggatccgcaagcgcaccagccacatcaccgtgatcgtggagagccgtccgcccaag
cagaagggcgcctccgccgcctcggcgcgtagccgtcgtgcgcagggcagcaaggctgct
gcgacgaagaagtctgccgagacgaaggagggctcggagtag

DBGET integrated database retrieval system