KEGG   Mycolicibacterium smegmatis MC2 155: MSMEI_6088Help
Entry
MSMEI_6088        CDS       T02191                                 

Definition
(GenBank) hypothetical protein
  KO
K18912  gamma-glutamyl hercynylcysteine S-oxide synthase [EC:1.14.99.50]
Organism
msg  Mycolicibacterium smegmatis MC2 155
Pathway
msg00340  Histidine metabolism
msg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    MSMEI_6088
Enzymes [BR:msg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.50  gamma-glutamyl hercynylcysteine S-oxide synthase
     MSMEI_6088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGE-sulfatase DinB_2
Motif
Other DBs
NCBI-ProteinID: AFP42519
UniProt: A0R5N0
Position
complement(6315868..6317154)
Genome map
AA seq 428 aa AA seqDB search
MIARETLADELALARERTLRLVEFDDAELHRQYNPLMSPLVWDLAHIGQQEELWLLRDGN
PDRPGMLAPEVDRLYDAFEHSRASRVNLPLLPPSDARAYCATVRAKALDTLDTLPEDDPG
FRFALVISHENQHDETMLQALNLREGPPLLDTGIPLPAGRPGVAGTSVLVPGGPFVLGVD
ALTEPHSLDNERPAHVVDIPSFRIGRVPVTNAEWREFIDDGGYDQPRWWSPRGWAHRQEA
GLVAPQFWNPDGTRTRFGHIEEIPGDEPVQHVTFFEAEAYAAWAGARLPTEIEWEKACAW
DPVAGARRRFPWGSAQPSAALANLGGDARRPAPVGAYPAGASAYGAEQMLGDVWEWTSSP
LRPWPGFTPMIYERYSTPFFEGTTSGDYRVLRGGSWAVAPGILRPSFRNWDHPIRRQIFS
GVRLAWDV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgcacgcgagacactggccgacgagctggccctggcccgcgaacgcacgttgcgg
ctcgtggagttcgacgacgcggaactgcatcgccagtacaacccgctgatgagcccgctc
gtgtgggacctcgcgcacatcgggcagcaggaagaactgtggctgctgcgcgacggcaac
cccgaccgccccggcatgctcgcacccgaggtggaccggctttacgacgcgttcgagcac
tcacgcgccagccgggtcaacctcccgttgctgccgccttcggatgcgcgcgcctactgc
gcgacggtgcgggccaaggcgctcgacaccctcgacacgctgcccgaggacgatccgggc
ttccggttcgcgctggtgatcagccacgagaaccagcacgacgagaccatgctgcaggca
ctcaacctgcgcgagggcccacccctgctcgacaccggaattcccctgcccgcgggcagg
ccaggcgtggcaggcacgtcggtgctggtgccgggcggcccgttcgtgctcggggtcgac
gcgctgaccgaaccgcactcactggacaacgaacggcccgcccacgtcgtggacatcccg
tcgttccggatcggccgcgtgccggtcaccaacgccgaatggcgcgagttcatcgacgac
ggtggctacgaccaaccgcgctggtggtcgccacgcggctgggcgcaccgccaggaggcg
ggcctggtggccccgcagttctggaaccccgacggcacccgcacccggttcgggcacatc
gaggagatcccgggtgacgaacccgtgcagcacgtgacgttcttcgaagccgaggcctac
gcggcgtgggccggtgctcggttgcccaccgagatcgaatgggagaaggcctgcgcgtgg
gatccggtcgccggtgctcggcgccggttcccctggggctcagcacaacccagcgcggcg
ctggccaacctcggcggtgacgcacgccgcccggcgccggtcggggcctacccggcgggg
gcgtcggcctatggcgccgagcagatgctgggcgacgtgtgggagtggacctcctcgccg
ctgcggccgtggcccggtttcacgccgatgatctacgagcgctacagcacgccgttcttc
gagggcaccacatccggtgactaccgcgtgctgcgcggcgggtcatgggccgttgcaccg
ggaatcctgcggcccagcttccgcaactgggaccacccgatccggcggcagatcttctcg
ggtgtccgcctggcctgggacgtctga

DBGET integrated database retrieval system