KEGG   Meiothermus silvanus: Mesil_3464Help
Entry
Mesil_3464        CDS       T01246                                 

Definition
(GenBank) hypothetical protein
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
msv  Meiothermus silvanus
Pathway
msv00740  Riboflavin metabolism
msv00790  Folate biosynthesis
msv01100  Metabolic pathways
msv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Mesil_3464
   00790 Folate biosynthesis
    Mesil_3464
Enzymes [BR:msv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Mesil_3464
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Mesil_3464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ADH65271
UniProt: D7BJB5
Position
pMESIL01:280825..282036
Genome map
AA seq 403 aa AA seqDB search
MSGVAPIEEILEEIRQGRPVLMVDDEYRENEGDFVLAAEHATPQMINLMLREGRGLVCLA
LTAPRAQALGLEPMVAYNTDPNGTAFTVSVDHRSAGTGISAFDRALTIRACLDPTTRPSD
LRRPGHLFPLVAREGGVLRRAGHTEAAVDLARLAGLEPAGVICEVVAEDGRMARLPQLLE
LARRLGLKLGTVRDLIAYRQRREPLVRREAEAFLPTAHGEFRLFGYVDPLNGGEHLALVM
GEVADGRPVLVRVHSECLTGDALHSLRCDCGAQRDAALAAIAAEGRGALLYLRQEGRGIG
LINKIRAYALQDQGADTVEANERLGFAADLRDYGVGAQILLDLGVRRLRLLTNNPRKGAA
LARFGLEVVEEVPLWAGHNPYNRRYLRTKQLRLGHRLWQEDVR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagcggggttgcccccatcgaggagattctcgaggaaattcggcagggccgacccgtg
ctgatggtggacgatgaatatcgcgagaacgaaggggattttgtcctggcagcggagcat
gctaccccgcagatgatcaacctgatgctgcgggagggacggggcctggtctgtctggcc
ctcaccgccccgcgggcccaggccttgggcttggaaccgatggttgcctacaataccgac
cccaacggcacggcttttaccgtctcggtggaccaccgctccgctggcaccgggatcagc
gccttcgaccgcgccctcaccattcgggcttgcctggaccccaccacccgtcctagcgac
ctgcgccgaccggggcatcttttccccctggtggcgcgcgagggtggggtgttgcggagg
gctggccacaccgaggctgcggtcgatttggcgcggctggccgggctcgagcccgcgggc
gtcatctgtgaggtagtcgccgaggacgggcggatggcccggctgccccaactcctcgag
cttgcccgtcggctaggccttaagttgggtaccgtgcgcgacctcatcgcttaccgccag
cgaagggagccccttgtccgaagggaggccgaggcgtttctgcctaccgcgcatggggag
tttcggctttttggctacgtagacccgctgaatgggggagagcacctggcgctggtgatg
ggtgaggtagccgatggacgcccagtcctggtgcgcgtgcacagcgagtgcctcaccggc
gacgccttgcactcgctgcgctgtgactgtggggcccagcgcgacgcggccttggcggcc
attgccgcagaggggcggggtgcgctgctatacctgcgccaagaggggcggggaatcggt
ctgatcaacaagatccgggcctacgccctccaggatcaaggggctgacacggtcgaggcc
aacgagcgcctgggttttgccgccgacctgcgcgattacggggtgggcgcgcaaatcctg
ctcgacctgggggtgcgccgcctgcgcctgctgaccaataacccgcgtaagggggcggct
ctggccaggtttggtctggaggtcgtagaggaggtgcccctttgggcgggccacaacccc
tacaaccggcggtatctgcggaccaaacagctccggctcgggcaccgtctgtggcaggag
gacgtgcgatga

DBGET integrated database retrieval system