KEGG   Moorella thermoacetica ATCC 39073: Moth_1960
Entry
Moth_1960         CDS       T00308                                 

Definition
(GenBank) xanthine dehydrogenase, molybdenum binding subunit apoprotein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
mta  Moorella thermoacetica ATCC 39073
Pathway
mta00230  Purine metabolism
mta01100  Metabolic pathways
mta01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mta00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Moth_1960
Enzymes [BR:mta01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Moth_1960
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ABC20258
UniProt: Q2RH31
Position
complement(2038062..2040353)
AA seq 763 aa
MASTAVGKSVTRVDAVAKVTGQAKYTGDFMFRDMLVGKVLRSPYAHAIVKNIDVSQARAL
PGVEGVLTYKDVPRNKFPTAGHPYSLDPAHGDKADRTILTDKARFVGDAIAAVIARDELT
AAEALKLIKVEYEVLEPLLTPEAAMREGAPLIHEDCPGNILSASGYAIGDVDEAFKEADY
IFEDELETSIVQHCQLENHISCAYVDSDGRIVIITSTQIPHIVRRIVGQALGIPWGRIRV
IKPYVGGGFGSKQDVCTEPLAAAMTLAVGGRPVKLELSREECMIATRTRHAFKFKIKTGV
SRDGRLIGMHIKAISNTGAYASHGHSIAMAGGSKFRILYPMKALKYEPFTVYTNLPVAGA
MRGYGSPQITFAVESHLDNIASKLNIDPIEFRLKNLVKEGYVDPLNGNAVRSCGIRECIA
RGKELIKWDEKKARYKNQTGSRRRGLGMACFSYGSGTYPVGLEIGGARIVLNQDGSVQLQ
VGATEIGQGSDTVFAQMVAEVLGIPVDMVHVLSTQDTDISPFDTGAYASRQTYITGMAVA
RAAAEVKEKILDFAWGMTDIPAHALDIKDANIVYKHSGEVVMPLAEVALHTYYDTVFAKP
ITSDTSNNARVNAFVFGVTFAEVEVDLKTGRIEVLEIYNVHDSGRIINRQLAAAQVHGGV
GMGIGYALSEQLLFDEKTGQPLNNNLLDYKLPTIMDIPAIGVDFVETFEPTSPFGCKALG
EPPIIPVAPAIRNAVFDATGVAFDRLPMNPQRVFEKFKEAGLI
NT seq 2292 nt   +upstreamnt  +downstreamnt
atggcttctacagcagtggggaagagtgtcaccagggttgatgctgtggccaaagttacc
gggcaagcaaagtataccggggattttatgttcagggacatgctggtcggtaaggtctta
agaagtccctatgcccatgccatcgttaaaaacattgatgtcagccaggccagggcttta
cccggcgtggaaggggtcctgacttataaggatgtaccgcggaataaattccccactgcc
gggcatccctattccctggatccggcccacggcgataaggccgaccgtaccatcctgacc
gataaagcccgcttcgtcggtgacgccatcgcggcggtaatagccagggatgagctgacg
gccgccgaggccctgaagcttattaaggtagagtacgaggtgttagaacccctcctcacc
ccggaggcagccatgcgggagggcgcgcccctgattcatgaggattgccctggcaacatc
ctcagtgccagtggctatgccatcggcgacgtcgacgaggcttttaaagaagccgactat
atctttgaggatgaactggaaactagcattgttcagcattgccagctggaaaatcatata
tcctgcgcttatgtcgacagcgacggccgcatagtgattataacctccacccagatcccc
catattgtcaggagaatcgtcggccaggccttgggtatcccttggggcaggatccgggta
atcaagccctacgtcgggggcggctttggtagcaaacaggatgtctgcaccgaacccctg
gccgcagccatgaccctggccgtggggggaaggccggtaaaactggaactttcccgggaa
gaatgcatgattgccacccgcacccgccatgccttcaagtttaagatcaaaaccggggtt
tcccgggacggcaggttaatcgggatgcatatcaaggccatttccaataccggggcctat
gcctcccacggtcattccatcgccatggccggtggttccaaattcaggattctttatccc
atgaaggctttgaaatatgaaccatttacagtttacaccaacctgccggtggcgggagcc
atgaggggttatggatcgccccagataacctttgccgtggaaagccatctggataacatc
gccagcaaactcaatatcgatcctattgagttccgtctgaaaaacctggttaaagagggt
tatgtcgatcctttaaatggcaacgcggtgcggagttgcggcattcgcgagtgcattgcc
cggggcaaagagttgatcaagtgggacgagaaaaaagcgcggtataaaaaccaaaccggc
agcagacgccggggcctgggcatggcctgcttcagctacggttccggcacttacccggtg
gggctggaaataggaggggcgcggatcgtcctgaaccaggacggttccgtccagctacag
gttggagctacagaaataggtcagggcagcgataccgtctttgcccagatggtagccgag
gtcctgggtattccggtggatatggtccatgtcctttccacccaggatacagatatttcc
ccctttgataccggtgcctatgcttcccggcagacctatatcaccggtatggcggtggcc
agggcggccgcggaggtcaaggagaagatcctggattttgcctgggggatgaccgatatc
ccagcccatgccctggatattaaagatgccaatatcgtctataaacactcgggcgaagtg
gtcatgcccctggccgaggtggccctgcacacctattacgacaccgttttcgccaaaccg
ataacgagcgatacctccaataatgcccgggtcaacgcctttgtttttggcgttaccttt
gccgaggtggaagtagacctgaaaaccggccggatcgaggtcctggagatatataacgtc
cacgattccggcaggattatcaaccgccagctggcggcagcccaggtccacggcggcgtg
ggcatgggcataggttatgccctctccgagcaattgctctttgacgagaagaccggccaa
ccactgaataacaatctgctggattacaaactgcctacgattatggatattcccgcaatc
ggcgtagattttgtggaaacctttgaacctaccagcccctttggctgcaaggctttaggc
gagccgccgattattcctgtggccccggccattcgtaatgccgttttcgacgccacgggc
gtggcttttgacaggttgcccatgaatccccaacgggttttcgaaaagttcaaggaagcc
gggttaatatag

DBGET integrated database retrieval system