KEGG   Mycobacterium tuberculosis H37Rv: Rv0986
Entry
Rv0986            CDS       T00015                                 
Name
(RefSeq) adhesion component ABC transporter ATP-binding protein
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtu02000]
    Rv0986
Transporters [BR:mtu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    Rv0986
SSDB
Motif
Pfam: ABC_tran RsgA_GTPase SMC_N AAA_21 AAA_29 AAA_16 AAA_23 AAA_25 MMR_HSR1 Dynamin_N G-alpha AAA_30 NACHT Zeta_toxin AAA_22 DLIC NB-ARC AAA_13
Other DBs
NCBI-GeneID: 885364
NCBI-ProteinID: NP_215501
TubercuList: Rv0986
UniProt: P9WQK1
Position
1101803..1102549
AA seq 248 aa
MNRQPIVQLSNLSWTFREGETRRQVLDHITFDFEPGEFVALLGQSGSGKSTLLNLISGIE
KPTTGDVTINGFAITQKTERDRTLFRRDQIGIVFQFFNLIPTLTVLENITLPQELAGVSQ
RKAAVVARDLLEKVGMADRERTFPDKLSGGEQQRVAISRALAHNPMLVLADEPTGNLDSD
TGDKVLDVLLDLTRQAGKTLIMATHSPSMTQHADRVVNLQGGRLIPAVNRENQTDQPAST
ILLPTSYE
NT seq 747 nt   +upstreamnt  +downstreamnt
atgaaccggcaacctatcgttcagctgagtaacttgagctggacattccgagaaggcgaa
acccgacgacaagtcctagaccacatcaccttcgatttcgagcccggtgagtttgtcgcg
ctgctggggcaaagtggaagtggtaaaagcactttgctgaacctcatcagtggcatagaa
aagcccaccacaggtgacgtcacaattaatgggttcgctatcactcagaaaaccgagcga
gaccggacgttgttccggcgcgatcagattggcatcgtctttcaatttttcaacctgatt
cccactcttaccgtgttggaaaatattacgctgcctcaggaactggccggagtttctcag
aggaaagcggccgtggtcgctcgtgaccttctcgaaaaagtgggcatggccgaccgtgaa
cgcacctttcccgataaactctccggcggagaacaacaacgggtcgctatttccagagcg
ttggcgcataatcccatgctggtgttagccgatgagccgaccggcaacctggactccgat
accggggataaagtcttggatgttctgcttgatctcacccgccaagcaggtaaaacctta
atcatggctacgcatagcccgtcgatgacgcagcatgccgaccgggtagtcaacttacag
ggcggcaggttgatacctgccgtgaaccgagaaaatcaaaccgaccagccggccagcacg
atcctattgcccacgtcatatgaatga

DBGET integrated database retrieval system