KEGG   Mycobacterium ulcerans: MUL_3370
Entry
MUL_3370          CDS       T00435                                 

Gene name
miaA
Definition
(GenBank) tRNA delta(2)-isopentenylpyrophosphate transferase MiaA
  KO
K00791  tRNA dimethylallyltransferase [EC:2.5.1.75]
Organism
mul  Mycobacterium ulcerans
Pathway
mul01100  Metabolic pathways
mul01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mul00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mul01006]
    MUL_3370 (miaA)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mul03016]
    MUL_3370 (miaA)
Enzymes [BR:mul01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.75  tRNA dimethylallyltransferase
     MUL_3370 (miaA)
Prenyltransferases [BR:mul01006]
 Compound prenylation
  tRNA dimethylallyltransferase
   MUL_3370 (miaA)
Transfer RNA biogenesis [BR:mul03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    MUL_3370 (miaA)
 Prokaryotic type
    MUL_3370 (miaA)
SSDB
Motif
Pfam: IPPT AAA_33 AAA_5 IPT Cytidylate_kin AAA_18 TIP49 AAA_22 AAA DUF87
Other DBs
NCBI-ProteinID: ABL05550
Pasteur: MUL_3370
UniProt: A0PT81
Position
complement(3740251..3741195)
AA seq 314 aa
MRPLAIIGPTGSGKSQLALDVAERLAGEVPAEIVNADAMQLYRGMDIGTAKLSVAARRGI
PHHQLDVLNVAETATVARYQQAAAADIEAIIARGHVPIVVGGSMLHVQSLLDNWSFPATD
PAVRARWEECLAELGVGELHAELARRDPAAAATILPTDGRRIVRALEVIELTGQPFAASA
PRIGAAQWGTAIIGLDCDTPILDDRLAVRTDSMFERGLVEEVRVLLRAGLRDGVTAARAL
GYAQVLAALDAGGGAELLDDAREQTYFGTRRYVRRQRSWFRRDHRVHWCDAGATGPSDRV
AMVDEALRVWRHVT
NT seq 945 nt   +upstreamnt  +downstreamnt
atgagaccactggcgatcatcggcccgacgggcagcggaaagtcgcaactggcgctcgac
gtggccgagcggctggccggcgaggtacccgcggagatcgtgaacgccgacgcgatgcag
ctctatcgcggcatggacatcggcaccgcgaagctgtcggtcgcagcgcgccgtggcatc
ccgcatcatcaactcgacgtcctcaacgtcgccgaaacggcgaccgtcgcccgctaccag
caggcggcggcggccgacatcgaggcgatcatcgctcgcgggcatgtgccgatcgtggtg
ggcggttccatgctccacgtccagtcgctgctcgacaactggtcgtttccggcaaccgat
ccggcggtgcgggccagatgggaagaatgtctggccgaactcggggtcggcgagctgcac
gccgaactggctcggcgcgacccggccgccgccgccacgatcctgcccaccgacggtcgc
cgcatcgtgcgcgcgctcgaggtcatcgagctcaccgggcagccgttcgccgcatccgcg
ccgcgcatcggcgccgcccaatggggcaccgcgattatcgggttggattgcgacacacca
attctggatgatcggctggcggtgcgcaccgattcgatgttcgagcggggcctggtcgag
gaagtgcgcgtgttgctgcgcgcgggtctgcgcgacggggtgaccgccgcgcgtgcgctg
ggttatgcccaggtgctcgcggctctcgacgccggcggcggcgcggagctactcgacgac
gcacgtgagcagacctatttcggtacccgccgttacgtccgacggcagcggtcgtggttt
cgccgggaccaccgagtgcactggtgcgacgccggcgcaaccggtccctccgatcgcgtc
gccatggtcgatgaggcgctgcgggtgtggcggcacgtaacctga

DBGET integrated database retrieval system