KEGG   Musa acuminata (wild Malaysian banana): 103976574Help
Entry
103976574         CDS       T03447                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mus00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103976574
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mus03041]
    103976574
Enzymes [BR:mus01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103976574
Spliceosome [BR:mus03041]
 Complex C
  Other components
   Step II factors
    103976574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD AAA_19 AAA_30 ABC_tran DUF4933 DUF2075 AAA_16 cobW Helicase_RecD AAA_23 AAA_14 AAA_33 T2SSE AAA_29 Sigma54_activ_2 DAP3 MMR_HSR1 ATPase_2
Motif
Other DBs
NCBI-GeneID: 103976574
NCBI-ProteinID: XP_009390104
Position
2
AA seq 704 aa AA seqDB search
MAVLPILQFEDKIAETVAENPVVVIIGETGSGKSTQLSQILHRRGYTRSGAIAVTQPRRV
AAVTVARRVAFELGSRLGEEVGYAIRFEDRTSDKTCIKYLTDGCLLRESLSNPELNQYSV
IILDEAHERSLNTDILLGLMKRLINRRSSNLKVLITSATLDGVKVSRFFSGCPVLNVPGI
LFPVEKLYSTERPTNYVECCLKTALDVHVREPPGDVLIFMTGQDDIDKMVFKLEEKIQNL
EEGSCMDAIVFPLHGSLPPELQIRVFSPAPPNCRRFIVATNIAETSLTVDGIVYVIDSGF
VKQRQYNPSTGMYSLDIVQISRVQADQRAGRAGRTRPGKCYRLYPRTVYDEEFLDATIPE
IQRSSLAGSVLYLKSLSLSDIDILKFDFLDPPSRESLEDALRQLYLIDAIDENGQITEIG
KAMAELPLEPSLARTLIEANELGCLSQALTVTSMLSAEVAIRPAHSKNKEKKRKQSFSKS
KLPDGSGWGDHIQLLQVYESWDRADYDPNWCTDNDLQVRSMMFSKDVRKQLSQIVQKMGK
GSLDVESGMRQKKSDKDYKKLRRALCRGYGNQLAERMLLHNGYHTLGYRSQLVQVHPSSV
LEADEDGQLPDYVVYHELINTSRPFMRNVCAVEISWVQPISKKLEKMNIDKLSGGSGASE
NNETIENKTINSPLQAVDASGPPGSMDSKIQAARERYLARKANR
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcctccccatcctccaattcgaggacaagatagcggagaccgtggcggagaac
ccggtggttgtgatcatcggcgagacgggctccgggaagagcacgcagctctcccagatc
ttgcaccgtcgggggtacacccgttccggtgcgatcgccgtcacccagcctcgccgggtc
gccgcggtcaccgtcgcgaggagggttgcatttgaactaggttctcgacttggtgaagaa
gtgggctatgcaattcgtttcgaagatcggacttctgataaaacctgcattaagtatcta
actgatggttgtcttcttcgagaaagcctatctaatccagaacttaaccagtactcagtt
attatcttggatgaagctcatgaacgcagtttgaacactgacatattgctgggcttaatg
aaacgcttaatcaatagacgctcctcaaatttgaaagttctcatcacttctgcaaccctt
gatggtgtcaaagtatctagatttttctccggatgccctgtattaaacgtcccagggata
ttattccctgtggaaaaattatacagcactgaacgacccacaaattatgtcgaatgctgt
ctgaagactgctctagatgtacatgtccgtgaaccgcctggagatgtcttgatttttatg
acaggacaggatgacattgataaaatggtgtttaagctggaggagaagattcaaaacctc
gaggaaggttcttgcatggatgctatagtctttccacttcatggttctttaccacctgaa
ttgcagattcgtgtattcagtccagcaccaccaaactgcagacggtttattgttgctacc
aacatagctgaaacttctctcactgttgatggtatcgtgtatgtcattgattctggtttt
gtgaagcagcgccaatataacccctcgaccggaatgtattctcttgatatcgtgcagata
agtagagttcaagctgatcaacgagctgggcgagccggaaggactcgtcctggcaagtgt
taccggttatatcctagaactgtttatgatgaggagtttcttgatgcaacaataccggaa
attcagcgatcatctcttgctggaagtgttctttacctgaagtcgttaagtctttctgat
attgatatcttgaagtttgattttctggatccaccatcacgtgaatcactagaagatgct
ttaaggcaattatacctcattgatgcaattgatgaaaatggacagataactgagattgga
aaagctatggctgagcttccattggaaccctcgcttgcaaggactttaattgaggcaaat
gagttgggatgtttgtctcaggctttgacagtcacatctatgctatcagcagaagttgca
attcgtcctgctcacagtaaaaacaaagagaagaagagaaaacaatcattttccaaatcc
aaactaccagatggttctgggtggggtgaccatatacaactgcttcaagtatatgaaagt
tgggaccgagccgactatgatccaaattggtgcactgacaatgacttgcaggtccgcagc
atgatgtttagcaaggatgtgaggaagcaactatctcagatagtacagaagatgggaaaa
gggtcattggacgtagaatcaggcatgcggcaaaaaaaaagtgataaagactacaaaaag
ctcaggagagctttatgcagaggctacggaaatcagttggccgaacggatgctgcttcac
aatggctatcatacacttggttacaggtcgcaacttgtgcaggttcatccatcctcggtg
ctagaagctgatgaagatggacagttgccagattatgttgtttaccatgaactcataaat
acctctcggccttttatgagaaacgtatgtgcagttgaaatttcatgggtccaaccaatc
tcaaagaaactggagaagatgaacattgacaagctgagtggtggctctggtgcttcagaa
aataatgagaccatcgagaacaaaacgataaattcacctttgcaagcggtagatgccagt
ggtccacctggttccatggatagtaaaattcaggcagcccgtgaacgatatcttgctaga
aaggcaaatagatag

DBGET integrated database retrieval system