KEGG   Aspergillus fischeri: NFIA_012720
Entry
NFIA_012720       CDS       T01070                                 

Definition
(RefSeq) nitrite reductase NiiA
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00910  Nitrogen metabolism
nfi01100  Metabolic pathways
Module
nfi_M00531  Assimilatory nitrate reduction, nitrate => ammonia
nfi_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    NFIA_012720
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     NFIA_012720
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Rieske_2 Rieske Fer2_BFD NIR_SIR_ferr Rubredoxin_C Amino_oxidase Rep_N
Other DBs
NCBI-GeneID: 4591541
NCBI-ProteinID: XP_001264480
UniProt: A1D2E0
AA seq 1102 aa
MPLIDSSRSNDAVQSSISNGISHATIVESVRDLDYRHNDPNRRQKIVVVGLGMVAISFIE
KIVKQDAERRKYDIVVIGEEPHIAYNRVGLSSFFEHRKIEDLYLNPKEWYGSFKDRSFDY
HLNTKVTDIFPEHKTVRTSTGDAIPYDILVLATGSDAVLPTHTPGYDAKGIFVYRTIQDL
ERLIEFASKHKGETAVTVGGGLLGLEAAKAMTDLEDFGKVKLIDRNKWVLARQLDGDAGT
LVTRKIRELGLDVLHEKRVAKIKTDDDNNVTGITFEDGEEIDCCCICFAIGVRPRDELGP
PAGIQCAGRGGFVINESLQTSIPDIFAIGECASWENQTFGIIAPGIEMADVLSFNLTNPD
KEPKSFKRPDMSTKLKLLGVDVASFGDFFADRDGPKFLPGQRPSIVDGSVRNADGDKEPN
VKALTYKDPFAGVYKKYLFTMDGKYLLGGMMIGDTKDYVKLNQMVKSQKPLEVPPSQFIL
GAQKDGEENADDLDDDAQICSCHNVTKGDIVENVKSGTCKTIGEIKSCTKAGSGCGGCMP
LVQSIFNKAMLDMGQEVSNHLCMHIPYSRADLYTVIAVKRLKTFVDVMQAVGRKPDSLGC
EICKPAIASILSSLFNQHIMDKELHDLQETNDRFLANIQRNGTFSVVPRVPGGEITADKL
ITIGQVAKKYNLYCKITGGQRIDLFGAKKQDLLDIWTELVDAGMESGHAYAKSLRTIKSC
VGTTWCRFGIGDSVGMAIRLEERYKSIRSPHKLKGAVSGCVRECAEAQNKDFGLIATEKG
YNIFVGGNGGAKPRHSELLAKDVPPEKLIPIIDRYLIFYIRTADKLQRTARWIENLPGGI
NYLREVIIDDKLGIGAEMEQQMEELVNSYFCEWTETVRNPKRRKYFQQFANSDETVDTVE
VIKEREQQRPTYWPKDSANEDFKGHQWSSLSWQPVIEANYFSDEHPQISSANIKRGDTQL
AIFKVKGKYYATQQMCPHKRAFVLSDGLIGDDDAGKYWVSCPYHKRNFELNGEQAGRCTN
DESMNIATFPVEERDDGWVYMKLPPVEELDSVLGTEKWKVKKGEAPDPFQKVDKRYKGMR
GKKACDIRTQAPTTQAANIIDW
NT seq 3309 nt   +upstreamnt  +downstreamnt
atgccgttgattgacagctcaagaagcaacgatgctgtccagagcagtatcagcaacggt
atatcccatgcgacaatcgtcgaatctgtcagagacctagattatcgtcacaatgacccg
aaccgacggcaaaagattgtggttgtcgggttgggcatggtagcgatctcattcattgag
aaaattgtcaaacaagatgcagagagacgcaagtacgacattgttgtgattggggaggag
cctcacattgcctataatcgtgtcggtctctcctcattttttgaacatcgcaagatcgag
gatttgtacctcaatcccaaggaatggtacgggtcgttcaaggaccggtcattcgattat
cacctcaacaccaaagtcaccgacattttccctgaacacaagaccgtcaggacgtcaact
ggcgacgccatcccctatgatattctagtcctcgctacaggctcagatgcagtactcccc
acacacactcctggctatgatgccaagggtatcttcgtttacagaacaattcaagacctg
gaacgtctcatcgagttcgcttcgaaacacaagggcgagaccgcggtcactgtaggagga
ggcttgctgggcctggaagcagccaaagcaatgacagatctcgaggacttcggaaaggtc
aaactcattgaccgcaacaagtgggttctggcacggcagctcgacggcgatgccggcaca
ctggtaactcggaagatcagagagcttggcctggacgtattacacgagaagcgggtcgcg
aagatcaaaacggatgacgacaacaacgtcactggcatcacctttgaagacggggaagag
attgactgctgctgcatttgttttgctattggagtgcgacccagagatgagctggggcct
cctgccggcattcagtgtgctggacggggaggttttgttatcaatgaaagtttacaaact
tccattcccgatatctttgccattggcgaatgtgctagttgggagaatcagacgttcgga
attatcgcacctgggattgaaatggccgacgtgctttccttcaacctgacaaatcccgat
aaggagccaaagagcttcaagcgacccgatatgagcacaaagctcaagctccttggtgtt
gacgttgccagctttggtgacttctttgccgacagagatgggcctaaattccttccgggg
caacggccatcgattgtcgatggctctgtgaggaacgctgatggcgacaaagagccaaat
gtcaaggcattgacatacaaggaccccttcgccggagtctacaagaagtacttgttcact
atggatgggaagtacttgcttggaggtatgatgattggcgataccaaggactacgtgaaa
ttgaaccagatggtcaagagccaaaagcctctcgaagtacctcccagtcagtttattctt
ggagcgcagaaggacggcgaagagaatgccgatgacttagacgacgacgctcagatctgc
tcgtgccacaatgtcacaaaaggggacatcgttgaaaacgtcaagagtggtacatgcaag
actattggcgagattaagtcgtgcacgaaagcagggagtggttgtggtggctgtatgcca
ttggtgcagtcgatcttcaacaaggccatgctggacatgggccaagaagtatccaaccat
ctctgcatgcacatcccatattcacgagccgatctttatactgtaatcgctgtcaagaga
ctgaaaacatttgtcgatgtcatgcaggccgtgggaaggaagccggactctcttggctgc
gagatttgcaaacctgccattgcatccattctttcaagtttgtttaaccagcacattatg
gacaaagagcttcatgaccttcaagagacaaatgaccgattccttgccaacatccagaga
aacggaacgttctctgtggttccgcgagtccctggtggtgagatcactgcggataagctg
atcaccattggtcaagtggcgaagaaatacaacctttactgcaagattacaggaggtcag
cgtattgacttgtttggtgccaagaagcaagatctacttgacatctggacggagctcgtg
gatgccggaatggagagtggtcatgcttatgccaagtcgctccgaacgatcaagagctgt
gtcggaactacatggtgccgctttggtatcggcgacagtgttggaatggcgatccgactg
gaggagcgctacaagagtattcggtcaccccataagctcaagggagcggtatctggttgt
gtcagagagtgcgccgaagctcagaacaaggatttcggattgattgcaaccgagaaggga
tacaacattttcgttggtggcaatggaggtgccaaacctcggcattcggaattgcttgcg
aaagatgtgcctcctgagaaactcattcctatcattgatcgatatctcatcttctatatt
agaacggcagacaaacttcagcggactgcccggtggatcgagaacctccccggcggtatc
aactatctgcgagaggtgatcatcgacgacaagttggggattggcgctgagatggaacag
cagatggaagaactggtgaacagctacttttgtgagtggaccgagacagtccgcaatcct
aagcgacgcaagtactttcaacagttcgccaacagcgacgagactgtcgacacggttgag
gtcatcaaagaacgtgaacagcagcgacccacatactggcccaaggactctgcaaacgag
gacttcaagggtcaccagtggtcgtctctatcatggcagcctgtcatcgaagccaactac
ttttcagatgagcacccgcaaatctcctcggccaacatcaagcgcggggatactcagttg
gccatcttcaaggtcaagggcaagtactacgccacacaacaaatgtgcccgcacaaacgc
gccttcgtgctatctgacggtttgattggtgatgacgatgcgggtaaatattgggtctct
tgcccttaccacaaacgcaacttcgagctcaacggtgagcaggcagggcgttgcacgaat
gacgagagcatgaacattgcgaccttccctgttgaggaacgcgatgacggctgggtgtat
atgaagctgccacccgttgaggaactagattcggttctgggaacggagaaatggaaggtg
aagaaaggggaagcaccagacccgttccagaaggtcgacaagaggtacaagggcatgagg
ggcaagaaggcttgtgacatccgtacgcaagccccgaccacacaggcggcaaacatcatc
gattggtag

DBGET integrated database retrieval system