KEGG   Aspergillus fischeri: NFIA_096810Help
Entry
NFIA_096810       CDS       T01070                                 

Definition
(RefSeq) n-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00520  Amino sugar and nucleotide sugar metabolism
nfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NFIA_096810
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     NFIA_096810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 4588596
NCBI-ProteinID: XP_001261956
UniProt: A1DB19
AA seq 430 aa AA seqDB search
MPGKTTTTPRITKFTNCRIVKGSELVEQDVWIDSLSGKILKDQEAFYGLHLSPDEVIDLG
GRILAPGLIDVQLNGAQGFDFSVPQASKEEYNEGLRLVNKGLARTGVTSYLPTVVSSTPE
VYWKVLPSLGPSGSNHRPEDGAESLGAHVEGPFINPNRNGIHKTEVLRAAQNFEDLEECY
GKENLTGSSKSVKMITVAPEVGNMVSTISSLTSAGIVCSIGHSDATFEQALSATTAGATM
VTHMFNAMRPFYHRNPGIFGLLGQSEHRRPFYGIIADGIHLHPTSIKIAYNAHQDGLVLV
TDAMKLCGLPDGVYDWTNGERIVKTGARLTLEGSDKIAGSSATLIECINNFRRWSGASIA
DAINAATATPARLLGLQGVKGSLDSGADADLVVLSEEDDPDSPTLTVCQVWKRGVKIHDT
DKGVTSTTTV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcaaaacgacgactactccgcgcatcaccaaattcaccaactgtcgcatcgtc
aagggttccgagcttgttgaacaggatgtctggatcgattctctgtcgggcaagattctc
aaagatcaggaggctttctacggattacatctttcgccggatgaggtcatcgacctcggc
gggcgtattctcgctccgggattgatcgatgtccagctaaacggcgctcagggttttgac
ttctctgtgcctcaagcgtccaaggaggaatataatgagggtttgcgcttggtgaacaag
ggccttgccaggaccggtgtgacttcatacttgcctactgttgtcagctcaaccccagag
gtttactggaaggtattgccctctttgggcccttcaggcagcaaccatcgtcctgaagat
ggcgcggaatcgttaggagcccatgtcgaaggacctttcatcaacccaaaccgcaatggc
attcacaagaccgaggtgcttcgtgctgcccagaatttcgaggatctagaggagtgttat
gggaaagagaatctcaccggaagctccaagtcagtcaagatgatcacggtcgcccccgag
gtgggaaacatggtatcgaccatctcctcattgacctctgccggcatcgtctgctccatc
ggtcactcggatgcgacattcgaacaagcgctctcagcgaccacagcgggcgctacaatg
gtcacgcatatgtttaatgcgatgcggcccttctaccaccgaaacccaggcattttcgga
ctgctgggccagagcgaacatcgcaggcccttctacggcatcatcgccgacggtatccat
ctgcacccgacctcgatcaagatcgcatacaacgcccatcaggacgggctcgtcctcgtg
accgatgcaatgaagctctgcggccttcccgacggtgtctatgattggacgaacggcgag
cgcatcgttaagacgggagcccggttgaccctggagggatccgacaagatcgcaggtagt
tcggccaccctgatcgagtgcatcaacaacttccggcgctggtctggcgcctctatagct
gatgccattaacgctgccacggcgactccggcacgcttactggggttacaaggcgtcaag
ggttccctggacagcggcgccgatgcggaccttgtcgtgctgagcgaggaagacgaccct
gactcgcccacgctaactgtctgccaggtgtggaaacggggagtcaagatccatgacact
gataaaggagttacgtctacgactacagtatga

DBGET integrated database retrieval system