KEGG   Nocardia farcinica NCTC11134: ERS450000_01181Help
Entry
ERS450000_01181   CDS       T04524                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase-2
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr00740  Riboflavin metabolism
nfr00790  Folate biosynthesis
nfr01100  Metabolic pathways
nfr01110  Biosynthesis of secondary metabolites
nfr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:nfr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ERS450000_01181 (ribA)
   00790 Folate biosynthesis
    ERS450000_01181 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ERS450000_01181 (ribA)
Enzymes [BR:nfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     ERS450000_01181 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: CRY75151
UniProt: A0A0H5NYJ0
Position
1:1177068..1177838
Genome map
AA seq 256 aa AA seqDB search
MTTVDPGTDTAHRLTRKGAELTVRVRELPADRDGGAVLVFGEIGQDCLVRIHSRCLYGDA
LQSDDCDCGPELERSMDLIQAEGRGVLVYLDQEGRGAGLVAKARGLREAERTGADTFTAY
TRLGYPEDARSFRLAAAAIAELGLRRVRLLTNNPDKAAALTDLGVAVTVVPLTTRPRSVR
ARKYLQDKRARRRHWLPEPSAPWAAGLAGPESTMVLPVLPDDAGWDEDGAGAVGGTRRSR
WGWLRGEGAGTAARRS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
ttgaccacagtcgaccccggcacggacaccgcgcatcgcctgacccgcaagggcgccgag
ctgaccgtccgggtccgggagttacccgccgaccgcgacggcggcgcggtgctggtgttc
ggcgagatcggccaggactgcctggtgcgcatccactcgcgctgcctctacggtgacgca
ctgcagtccgacgactgcgattgcggccccgaactcgaacggtccatggacctgatccag
gccgaggggcgcggcgtgctggtgtatctggaccaggagggccgtggcgccgggctcgtc
gccaaggcgcgtggcctgcgcgaggccgagcgcaccggcgcggacaccttcaccgcctat
acccgcctgggctatcccgaggacgcgcggtcgttccggctcgccgccgccgcgatcgcc
gagctcggcctgcgccgggtgcggctgctgaccaacaaccccgacaaggccgccgcgctc
accgatctgggtgtcgcggtgaccgtggtgccgttgaccacccgtccgcgcagtgtccgg
gcgcggaagtacctgcaggacaagcgggcacggcgcaggcattggctgcccgagccgtcg
gcgccgtgggcggccgggctggccgggcccgagagcacgatggtgctgccggtgctgccc
gacgacgccggctgggacgaggacggcgcgggggcggtcggcgggacacgccgctcccgg
tgggggtggctgcgcggcgagggggccggcaccgccgcgcgccggtcctga

DBGET integrated database retrieval system