KEGG   Nothobranchius furzeri (turquoise killifish): 107377918
Entry
107377918         CDS       T05163                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04080  Neuroactive ligand-receptor interaction
nfu04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107377918 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107377918 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 107377918
NCBI-ProteinID: XP_015803356
Position
sgr01
AA seq 70 aa
MTLLLTLSVTLIVVVAAGPMASTEHGRGLEEASTARKMVQQNPVRGGQTHRPAKRRRPRP
RLSHKGPMPF
NT seq 213 nt   +upstreamnt  +downstreamnt
atgacccttttgctaacattaagtgttacattgatagtggttgtagcggcaggtcccatg
gcctccacggagcatggcagagggctggaagaggcttctacggcgagaaaaatggtccag
cagaatcctgtgagaggtggtcaaacccacagaccagccaagagaagacgcccacggccc
cgtctttcccacaaggggcccatgccgttctag

DBGET integrated database retrieval system