KEGG   Naegleria gruberi: NAEGRDRAFT_56285
Entry
NAEGRDRAFT_56285  CDS       T01241                                 

Definition
(RefSeq) alpha-actinin
  KO
K05699  actinin alpha 1/4
Organism
ngr  Naegleria gruberi
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngr04131]
    NAEGRDRAFT_56285
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ngr04812]
    NAEGRDRAFT_56285
   04147 Exosome [BR:ngr04147]
    NAEGRDRAFT_56285
Membrane trafficking [BR:ngr04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    NAEGRDRAFT_56285
Cytoskeleton proteins [BR:ngr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     NAEGRDRAFT_56285
Exosome [BR:ngr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NAEGRDRAFT_56285
  Exosomal proteins of colorectal cancer cells
   NAEGRDRAFT_56285
  Exosomal proteins of bladder cancer cells
   NAEGRDRAFT_56285
SSDB
Motif
Pfam: CH EF-hand_1 Spectrin EF-hand_6 EF-hand_7 EFhand_Ca_insen EF-hand_5 CAMSAP_CH EF-hand_8 EF-hand_4 ExbD DUF1515 MCU
Other DBs
NCBI-GeneID: 8864571
NCBI-ProteinID: XP_002673568
JGI: Naegr1_56285
AA seq 852 aa
MSAEWERIQMRAFTKWVNSHLRKRSIQVEDIIEEFETGVPLIHLYEVISDETLGQFYANP
RMKFHKIANLNLVVDKVNSFIGSVGIRLQFSAEQIVNKEKTQILGMIWCLIHKFEIQDIS
EDELSAREGLLLWCKKKTKGYNNVNVKDFKGSWQDGLAFCALIHKHRPDLLDFDSLDPTN
ARENLQLAFDVAEKHLDIPQLLDADDMIKFTPDDKSVMTYVAYYWKRFASSNRNEKAGRK
LAKVAQREQELNNMKNDYEKRAQALVDWIDTNTDSLSDPTFEHFGDSLAKAEDKKEEFRK
FKDQEKPNQSSEKNDLELLLSNIRTKQKNEGLPIYNPPTDLSTATINDKWDGLNKKQDTY
DKALREHITLMKKLEILLSRFRVRAKKISEWQDGKNKGYFKEDLNKLDTVSALQAKINIH
ETFEDELAGVNKSLNETNAIGDKIVEGRHEAAPEVKSTMDKLKNGQDDVKQKSDDKKQEL
DDRLKNLEALLGKCLDLAKKSEGLAMFLDDISLALLEPITASSVKDVDVFVDILGDVENR
HAEQAPLLDAINQLVDEIKNAGGDPNLYSAVNNNDLDNQFKEAGNLISDRKKNLEEEKRR
LSGNEELLAQFAQLCDKYTEFAVEQKDGLNTIRQNTENLEEQLQKVKEQAAVIRAESEKQ
YESLISVLKDLEAREILELSKVTESEIKSVRDNLEKFVDKSIYEIESTLLTDKNEGLTEE
QIKDFRETFKYFDKDKDGKLSKQDFKACVCSLGEDIDDKEVEKVFAVVDTDKDGFVEFNE
FLGYMRRIGSEGSGYEDVMESFKQLAGEKDFITEAQLRSVMEPAEADFLLQQMPKKGDGY
DYVAYCNNTFNK
NT seq 2559 nt   +upstreamnt  +downstreamnt
atgtctgctgaatgggaacgtatccaaatgagagccttcaccaagtgggtcaactctcat
ctccgtaagagaagcatccaagtcgaagatatcattgaagaattcgaaacaggtgtccca
ttgattcacttgtatgaagtcatttctgatgaaaccttgggtcaattctatgctaatcca
cgtatgaagttccacaagattgccaacttgaatttggttgttgataaagtcaacagtttc
attggaagtgttggtattcgtttgcaattctctgctgaacaaattgtcaataaggaaaag
acacaaatcttgggtatgatttggtgtttgattcacaagtttgaaattcaagacatttct
gaagatgaactttctgccagagaaggtttattgttgtggtgtaagaaaaagaccaagggt
tacaacaatgtcaatgttaaagatttcaagggatcatggcaagatggtttggctttctgt
gccttgattcacaaacacagacctgatttgttagattttgactctttggatccaaccaat
gctagggaaaatctccaacttgcctttgatgttgctgaaaagcatttggatattccacaa
ttgttagatgctgatgacatgatcaagtttactcctgatgataagtcagtcatgacctat
gttgcttattattggaaacgtttcgcttccagtaatagaaatgaaaaggctggtcgtaaa
ttggctaaggttgctcaacgtgaacaagaattgaacaacatgaagaatgattatgaaaag
cgtgctcaagctttggttgactggattgataccaacactgactcactttctgatccaact
ttcgaacactttggtgattcattggccaaagctgaagataagaaggaagaattcagaaag
ttcaaggatcaagaaaagccaaatcaatcatcagaaaagaacgatttggaattgttattg
tccaacattcgtaccaagcaaaagaacgaaggtttaccaatctacaatccaccaactgat
ttgtcaactgccaccatcaatgacaagtgggacggtttgaacaagaagcaagatacttat
gataaggccttgagagaacatatcactttgatgaagaagttggaaatcttattgtctcgt
ttcagagttcgtgccaagaagatttctgaatggcaagatggtaagaataagggttacttc
aaggaagatttgaacaagttagatactgtctcagcattgcaagccaagattaacattcac
gaaacctttgaagatgaattggctggtgttaacaagtcattgaatgaaaccaatgctatt
ggtgataagattgttgaaggtagacatgaagctgctccagaagtcaagtcaactatggat
aagttgaagaatggtcaagatgatgtcaagcaaaagtctgatgataagaaacaagaatta
gacgacagattgaagaacttggaagcattgttgggcaagtgtttggatttggctaagaaa
tctgaaggtttggccatgttcttggatgatatttcccttgctttgctcgaaccaatcact
gcttcaagtgttaaggatgttgacgtctttgttgacattttgggtgacgttgaaaatcgt
catgctgaacaagctccattgttggatgctatcaatcaattggttgatgaaattaagaat
gctggtggtgatccaaacttatactctgctgttaataacaatgatttggacaaccaattc
aaggaagctggtaacctcatttctgacagaaagaagaatttggaagaagaaaagagaaga
ttgtcaggtaacgaagaattgttggctcaattcgctcaattgtgtgacaagtacactgaa
tttgctgttgaacaaaaggacggtttgaacactatcagacaaaacactgaaaatctcgaa
gaacaattgcaaaaggttaaggaacaagctgctgttatcagagctgaatctgaaaagcaa
tacgaatccttgatctctgtcttgaaggatttggaagctcgtgaaattctcgaattgtca
aaggttactgaatctgaaatcaagtcagttcgtgacaatttggaaaagttcgtcgacaag
tcaatctacgaaattgaatccactctcctcactgataagaacgaaggtttgactgaagaa
caaattaaggactttagagaaaccttcaagtactttgataaggacaaagatggcaagttg
tcaaagcaagatttcaaggcctgtgtctgttcattgggtgaagatattgatgataaggaa
gtcgaaaaggtctttgctgtcgttgatactgataaggatggtttcgttgaattcaatgaa
ttcttgggttacatgagaagaattggttctgaaggttctggttatgaggacgttatggaa
tcattcaagcaattggcaggtgaaaaggactttatcacagaagctcaattgagatctgtt
atggaaccagctgaagctgatttcttgttgcaacaaatgccaaagaagggtgacggttat
gactatgttgcctactgtaacaatactttcaataagtaa

DBGET integrated database retrieval system