KEGG   Nectria haematococca: NECHADRAFT_122417Help
Entry
NECHADRAFT_122417 CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
nhe  Nectria haematococca
Pathway
nhe00520  Amino sugar and nucleotide sugar metabolism
nhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NECHADRAFT_122417
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     NECHADRAFT_122417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 9671002
NCBI-ProteinID: XP_003052939
JGI: 122417
UniProt: C7YLA9
Position
3
AA seq 426 aa AA seqDB search
MPSVISSGGITKFTNCRLARGDNLVSEDLWVSSHTGTILSSQATFFDSGTLPDHAIDLGG
RIISPGLIDVQLNGAFGFNFSTLPDDITEYPKAVADVNKKLTTTGVTSYVPTLTSQKPIL
YQKVLPFLRPSRLRFAHDGAESLGAHVEGPFLNPGKNGVHDVNVLQEAFSFQDIEACYGV
ENLGKKGEPDSEPAPIKKITLAPERGNMAQLIPELTSRGIVCSIGHSEATYEEASDAVAA
GATMITHLFNAMRSLHHRNPGIFGVLGVVTDQLPRPYFGIIADGIHLHPTAVNIAFNAHP
EGFILVTDAMHLVGLPDAVYPWTNGDVDSRIVKVGPTLLLEGTDKIAGSSITLIECVNNL
LKWSGASIGKALKAVTSTPAAMLGIQDRKGSLSVGADADLLVIDEVWKFGTQVYLRKGVT
VMAKMA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgccctctgtcatctcttcgggtggtatcaccaagtttaccaactgccgcctcgcccgt
ggggacaatctcgtatccgaggacctttgggtgagctctcacactggtactatcctatct
agccaggccacctttttcgattctggcactctgcccgaccacgccattgatctcgggggc
cgtatcatctctcctggtttgatcgacgtccagctcaatggggcattcggcttcaacttt
tcgacattgcccgacgacatcacagagtatccaaaggctgtcgcggatgtgaataagaag
ttgaccactacgggtgtcacttcatatgtcccgacactgaccagtcaaaagccaatcctc
tatcaaaaggtgctaccttttcttcgtccaagccgccttcggtttgcccacgacggagca
gagtccctgggtgcacatgtagagggtcctttcctcaacccaggaaaaaatggcgttcat
gatgtcaacgtgctccaggaggccttcagcttccaagatattgaagcctgctacggcgtg
gagaatctgggcaaaaagggggagccagactctgaacccgccccgataaaaaagatcacc
ctcgccccggagcgcgggaacatggcacagctcatccctgagctgaccagtcgaggcatc
gtctgttctattggacactctgaggcgacgtacgaagaggcgtcggatgcagtcgcagct
ggggctacaatgatcacacatttgttcaatgctatgaggtctctccatcaccgcaatcca
ggaatctttggcgtacttggcgtcgttactgaccagctcccgaggccatactttggtatc
atcgccgatggcattcaccttcatcccaccgctgtcaacatcgctttcaatgctcacccg
gaaggcttcattctcgtcactgatgccatgcacctggttggactcccagatgccgtgtat
ccctggaccaacggcgacgtggacagtaggatcgtaaaagttgggccgacgttattactg
gaagggacagacaagattgcaggaagttccatcacgttgatcgagtgtgtaaacaacctt
ctcaaatggtcaggtgcctcgatcggcaaagcactcaaggcagtcacttcaacaccagca
gccatgcttggtattcaagaccgcaaaggaagtctaagcgtgggtgctgacgctgatctt
ctggtaattgatgaagtctggaagtttggcactcaggtctacttgcgaaaaggggtaact
gtgatggcgaagatggcatag

DBGET integrated database retrieval system