KEGG   Fusarium vanettenii: NECHADRAFT_77775
Entry
NECHADRAFT_77775  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
nhe  Fusarium vanettenii
Pathway
nhe00910  Nitrogen metabolism
nhe01100  Metabolic pathways
Module
nhe_M00531  Assimilatory nitrate reduction, nitrate => ammonia
nhe_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    NECHADRAFT_77775
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     NECHADRAFT_77775
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Fer2_BFD Pyr_redox Rieske Rieske_2 NIR_SIR_ferr Rubredoxin_C FAD_binding_2 CutC
Other DBs
NCBI-GeneID: 9663954
NCBI-ProteinID: XP_003052602
JGI: 77775
UniProt: C7YM65
Position
3
AA seq 1089 aa
MSETQKRLVVVGLGMVGIAFIEKLLKYDATAKEYSVTVLGEEPYLAYNRVGLTSFFEHRK
IENLYMNPAEWYAEAEGSLNYHVNTKATSINTDDKTVECANGETYPYDILVLATGSDAIL
PRGLPGHDANGVFVYRTIDDLKKLIEFADSKHGTNGVVVGGGLLGLEAAKAMLDLERFNK
IRLLEKAPYVLSRQLDDVAGKMVVDQVSQLGVDVMLGKGVSRIKTDEENKLTGVVFEDSQ
EIDCSTLCFAVGVKPRDDLARVSGLELGQRGGIVVNDDLRTSMPDIYAIGECASWRGMAY
GLIAPGVEMAEVLAFNLTQAKLHSPRTFKRPDLSTKLKLLGVNVASFGDCFADRDGPASL
PPKFAKNLQNGDVSSAKSVQALTYKDPFLNIYKKYIFTKDGKYLLGGMMLGDVNDYVKLV
PMVKSMKELDVPPSELILGAKKDDDGGDDLPDDAQVCSCHNVTKGDIVKVVKDGTCKDVT
SLKKCTKAGTGCGGCVPLITTIFNQTMASMGNEVTNYLCPHFNYSRVDLFNIVMVKRLKS
LPEVMREVGNDKTSVGCELCKPAVASIMASLWNRHVMDKTTYGLQDTNDRFLGNIQRDGT
YSVVPRVSGGEITPEKLVAIGEVARKYNLYTKITGGQRIDLFGAKKQDLLDIWGQLVAAG
MESGHAYAKSLRTVKSCVGSTWCRFGIGDSVGMAIRLEERYKSVRAPHKIKGGVSGCVRE
CAEAQSKDFGLIATEKGFNIFVGGNGGAKPRHAELLAKDVPPAEVVPILDRYLMFYIRTA
DKLQRTARWIENLPGGLKYLQEVILDDKLGICASLEAQMNELVDSFFDEWAEAIRTPAIA
AKFRQFNNTAETTPNMEVESDRGQKRPAFWVGDAATDDFQGLKDKWSMTAWEPIIETSYF
DGADELPNGISATIKRGDTQLAVWRIQGVYYATQQMCPHKRAFILSDGLVGQEPCDKKKS
SDAPEDTKTSPWVSCPHHKRNFDLGNGSCKTDEKLSIATFPTEARPDGMLYLKLPPVEEL
DAALGTRKWMVKKGEAGEAPLAELDRRINFVGLRGKKPGVRPTAGGKMSTKPLELMAAAN
GCGGGAPEW
NT seq 3270 nt   +upstreamnt  +downstreamnt
atgagtgaaacacagaaacgcctggtcgttgtcggactgggcatggtgggcattgctttc
atagaaaagctgctcaagtacgatgccacagcaaaagaatactctgttactgttcttgga
gaggagccatatctcgcctacaaccgagtaggacttacgagtttctttgagcaccggaag
attgagaatttgtacatgaacccagcagaatggtatgccgaggcagagggatctctcaac
taccacgtcaacaccaaagccactagtatcaacacagacgacaagacggtcgaatgcgcc
aacggcgagacatacccttacgacatcctcgtcctggctaccggctccgatgctatcctt
ccccgaggtcttcccggtcatgacgccaacggtgtttttgtttaccgcacaatcgacgat
ctcaagaaactcatcgagtttgccgactcgaagcatggtaccaacggtgtggttgtcggt
ggcggcctgctcggtctcgaagctgccaaggccatgttagacctagagcgattcaacaag
atcagactgctggagaaggcaccctatgtcctgagcagacaactcgatgatgttgctggc
aagatggtggtggaccaggtctcacagctcggcgtggacgtcatgctcggcaagggtgtt
tccagaatcaagactgatgaggagaacaagctcaccggtgtggtgtttgaagattcccaa
gagattgactgctcaacgctgtgcttcgctgtcggtgtaaagcccagagatgaccttgct
agggtctctggacttgagctcggtcagcgaggtggtatcgtcgtcaacgacgacttgaga
acaagcatgccagacatctacgccattggagagtgtgccagctggaggggaatggcctat
ggtcttatcgcccccggtgtcgaaatggcagaagtcctcgccttcaacctcacccaagca
aaacttcactcgccccgaacctttaagcgtcccgacctgagcacaaaactcaagcttctt
ggtgtcaacgtcgccagcttcggtgactgcttcgccgaccgtgatggtcctgcatctctt
ccacccaagtttgccaagaacttgcaaaacggtgacgtttcttcggccaagtcggtgcag
gccttgacatacaaggacccttttctcaacatctacaagaagtacatctttaccaaggat
ggcaagtaccttcttggtggtatgatgcttggcgatgtcaatgactatgtcaagctcgtg
cccatggtcaagtccatgaaggagcttgatgttcccccaagcgaactcattcttggtgca
aagaaggacgacgatggtggcgacgacctccccgatgatgcgcaggtgtgttcgtgccac
aacgtgacaaagggtgatatcgtcaaggtcgtcaaggacggtacctgcaaggatgtcacg
agtctcaagaagtgcacaaaggccggtacaggctgtggtggttgcgttcccctcattacc
accatcttcaaccagaccatggcatccatgggcaacgaggtgacaaactacctctgccct
cacttcaactactcccgtgtggatctcttcaacattgtcatggtgaagcgtctcaagtcg
ctgccagaggtgatgcgcgaggttggaaacgacaagaccagtgtcggctgcgagctgtgc
aagcctgccgtggcgagcatcatggcctcgctctggaacagacacgtcatggacaagacc
acctacggtcttcaagataccaacgatcgcttcctgggcaacatccagcgtgacggcaca
tattccgtcgtcccccgtgtgtcgggtggagagatcactcccgagaagcttgtcgctatc
ggtgaggtggcgagaaagtacaacctctacaccaagatcacaggtggtcagcgtatcgat
ttgtttggagccaagaagcaggatctcctcgacatctggggtcagcttgtcgctgccggc
atggaatccggccacgcctacgccaagtccctacgtacggtcaagagctgcgtcggctca
acatggtgccgattcggtattggcgacagcgtcggcatggctattcgtctcgaggagcgg
tacaagagtgtacgagcaccgcacaagatcaagggtggtgtaagtggttgcgtgcgtgag
tgtgctgaagcccaaagcaaagatttcggtttgatcgccacggaaaagggcttcaatatc
tttgttggcggtaacggaggcgcaaagcctcgccatgccgagttgttggcaaaggatgtg
cctcccgccgaagtggtacccatcctggaccgttacctcatgttctacatccgcacagca
gacaagcttcagcgtacggcacgttggatcgagaatctccctggtggtctcaagtatctc
caagaggtcatcctcgacgacaagctaggcatctgcgcgtcactcgaggcccagatgaat
gagctcgtcgacagcttctttgacgagtgggccgaagcaatccgcacacctgccatcgcc
gccaagttccgacaattcaacaacacagccgagacgacgcccaacatggaagtcgagtct
gatcgcggacagaagcggcccgcgttctgggtgggcgacgccgccactgacgacttccag
ggcctcaaggacaagtggtccatgacggcgtgggagcccatcatcgagacgtcctacttt
gacggcgctgatgagctgcccaatggcatatccgccaccatcaagcgcggcgatactcag
cttgctgtctggcgcatccagggcgtttactacgccacgcagcaaatgtgtcctcacaag
cgtgccttcatcctctccgacggtctcgtcggtcaggagccctgtgacaagaaaaagtcc
tctgacgcccctgaggataccaagacctcaccttgggtctcgtgcccacaccacaagcgc
aactttgacctcggaaacggctcctgcaagacggatgagaagctctccatcgccacgttc
cccaccgaggcccgtcccgatggcatgctgtacctcaagctccctcccgtggaggagctc
gatgccgcgctgggcacaaggaagtggatggtcaagaagggagaggctggcgaggcgccg
ctggccgagctagatagacgtatcaattttgttggtctgcgcggtaagaagccaggcgtg
aggccaacggctggtggtaagatgtcaaccaagcccctggagctgatggctgctgccaat
ggctgtggaggtggtgcaccagaatggtag

DBGET integrated database retrieval system