KEGG   Nitrosomonas sp. AL212: NAL212_0113
Entry
NAL212_0113       CDS       T01443                                 
Name
(GenBank) type IV secretion/conjugal transfer ATPase, VirB4 family
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:nit00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NAL212_0113
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:nit02044]
    NAL212_0113
Enzymes [BR:nit01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     NAL212_0113
Secretion system [BR:nit02044]
 Type IV secretion system
  Trb secretion system protein
   NAL212_0113
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_22 AAA_10 ABC_tran AAA_29 DUF87
Other DBs
NCBI-ProteinID: ADZ28057
UniProt: F0TD67
Position
pNAL21202:complement(12389..14923)
AA seq 844 aa
MIAAMIILIAMCGALLLLMLFVRIRDAGKELRLDQHRSKEMGFADLLVYAAVVEDGVIVG
KNGALMAAWIFYGDDTASSTDIERERVSYQINQALSRLGNGWMIHVDAIRKPALAYSDKA
HSNYPDPITAAIDQERRNLFERIGTLYESCFIVSLTYLPPMLVQRKFVELMFDDDTQPPD
QKARTQGLLEYFQRECANFESRLSSVFHLSRLKSRKIVNEDSTTIIHDDFLQWLQLCITG
LDHPMVLPDNPMYLDTLLGGQEMWGGVVPKIGRNFVQVVSIEGFPLESSPGMLNLLSELP
GVYRWSSRFIFMDTHEAVNHLEKYRRRWKQKIRGFLDQVFNLQSSNIDEDALNMVDDAQS
AIAETNSGMVGQGYYTSVVVLMMEDRAALEEAGRKVEKAINHLGFAARVETINTMDAYLG
SLPGHGVENVRRPLINTMNLADLLPVNTIWTGKPIAPCPMYPPNSPPLMHCVTQGATPFR
LNLHVRDLGHTFMFGPTGAGKSTHLALIAAQLRRYQGMSIYCFDKGMSMYPLTRAVGGQH
FTVAGDDESLAFCPLQFLQSKSDRAWALEWICLMVELNGITVTPLQRNEISHAIANMHQS
GSHTLSDFLMTIQDEAIREALRQYSIDGMMGHLLDAEEDGLNLSTFTTFEIEELMNLGDK
YALPTLLYLFRRIERSLHGQPSAIILDEAWLMLGHPVFRAKIREWLKVMRKNNCLVLMAT
QSLSDAANSGILDVIVESTATKIFLPNVFARDEEASALYRRMGLNSRQIEILASAIPKQQ
YYTVSENGRRLYDLALGPLALALIGSTDKESIATIKNLHDKHGDRWVIEWLAIKGLTLSD
YGVA
NT seq 2535 nt   +upstreamnt  +downstreamnt
atgattgccgcaatgatcatactcatcgcaatgtgcggtgctttgctgcttctgatgctg
tttgtgcgtattcgtgatgctggcaaagaattaaggctggatcaacatcgatcaaaagaa
atgggctttgccgatttactggtgtatgcagcggtggtggaagatggcgtgatagtcggc
aagaatggtgcattgatggccgcctggatattctatggtgatgatactgccagcagtacc
gatatcgagcgtgaacgggtgtcgtatcaaattaaccaggcattatcccgtttgggcaat
ggctggatgattcatgtcgatgcaatccgcaaacctgcgttagcgtattcagacaaagcc
cactccaattatcctgatcccattaccgctgccattgaccaggaacggcgaaatctgttc
gagcgtatcggcaccctatacgagagttgctttatcgtatcactgacctatttgccgccg
atgttggtacagcgcaagttcgtagaactcatgtttgatgacgatacccagccacccgac
cagaaagccagaacacaagggctgctggaatatttccagcgtgaatgtgccaattttgaa
tccagattatccagcgtatttcatctgtcgcgcttaaaaagccgcaaaatcgtcaatgaa
gacagtacaaccatcatccatgatgatttcttacagtggctgcaattatgtattaccggc
ctggatcatcccatggtattacctgacaatcccatgtatctggacacgctgctgggtggt
caggaaatgtggggcggggttgtacctaagattggccgcaatttcgttcaggtggtctcg
attgagggttttcccttggaatcctcacccggcatgttgaatctgctatccgaattgccg
ggcgtgtaccgctggtcatcgcggtttatctttatggatacgcatgaggcggtcaatcat
ctggagaaataccgcagaaggtggaaacaaaagattcgcggttttctggatcaggtattt
aacctgcaaagcagcaacatcgatgaggacgcgctcaatatggttgatgatgcgcagtct
gccattgctgagaccaatagcggcatggtgggccaagggtactataccagcgtggttgtg
ctcatgatggaagatcgggcggcgttggaagaagccgggcgaaaggtagagaaagcaatc
aatcatctgggttttgccgcacgggttgaaacgatcaacacgatggatgcctatctggga
agcctgccagggcatggtgtagaaaatgtgcgcagacccctcatcaataccatgaatctg
gctgatctgttgccggtcaataccatctggactggaaagcctatcgcgccttgtccgatg
tatccacccaattcaccacccttgatgcactgtgttacacaaggcgctacgcctttccgg
ttgaatctgcatgtacgcgatttaggtcacaccttcatgttcggtcccactggagcgggt
aaatccacgcacctggcgctgattgctgcgcaattgagacgctaccagggcatgtcaatt
tattgctttgacaagggaatgtcgatgtatccattgacccgtgccgtgggtggccagcat
ttcaccgtggcaggggatgatgaatcgctagctttctgtccattgcagttcttgcagtcc
aagagcgatcgggcctgggcgctggaatggatttgtttgatggttgaactcaacggcatt
accgttacacccttgcagcgcaatgaaatcagtcacgctattgccaacatgcatcaaagc
ggctcgcacaccttatcggattttctgatgactatccaggatgaggcgatacgcgaggcg
ctgcggcaatactctatcgacggcatgatggggcatttactcgatgccgaggaggacggg
ttgaatctttcaactttcaccacattcgagatcgaggaattgatgaatctcggtgataaa
tacgctctccccacattgttgtatctctttcgccgtattgagcgcagcctgcatggtcag
ccttccgccatcattctggatgaagcttggctgatgctgggtcatccggtgtttcgcgcc
aagatcagggaatggctcaaggtcatgcgtaaaaacaattgcctggtgttgatggcaacc
caaagtctgtcggacgccgcaaacagtggcattctcgatgtcattgttgaatccaccgcc
accaagatatttctacccaatgtattcgcgcgtgatgaggaggcttcggcactctatcgg
cgcatgggattaaatagtcgccagattgagattctggcttctgccattcccaaacagcaa
tattacacggtgtccgagaacggcaggcgactctacgacctggcactcgggccattagcg
ttagcgcttataggatccacggataaggaatcgattgcaaccatcaaaaacctgcatgac
aagcatggagaccgctgggttattgagtggttggcgattaaaggattaacgttatctgac
tatggagtggcttga

DBGET integrated database retrieval system