KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100580130Help
Entry
100580130         CDS       T03265                                 

Gene name
DHRS11
Definition
(RefSeq) dehydrogenase/reductase SDR family member 11
  KO
K22970  17beta-estradiol 17-dehydrogenase / 3beta-hydroxysteroid 3-dehydrogenase [EC:1.1.1.62 1.1.1.270]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00140  Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100580130 (DHRS11)
Enzymes [BR:nle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     100580130 (DHRS11)
    1.1.1.270  3beta-hydroxysteroid 3-dehydrogenase
     100580130 (DHRS11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_10 GDP_Man_Dehyd NmrA RmlD_sub_bind Shikimate_DH F420_oxidored Sacchrp_dh_NADP Guanylin
Motif
Other DBs
NCBI-GeneID: 100580130
NCBI-ProteinID: XP_003278432
Ensembl: ENSNLEG00000002259
UniProt: G1QP81
Position
Unknown
AA seq 260 aa AA seqDB search
MARPGMERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGY
PGTLIPYRCDLSNEEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNV
NVLALSICTREAYQSMKERNVDDGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGL
RQELREAQTHIRATCISPGVVETQFAFKLHDKDPEKAAAAYEQMKCLKPEDVAEAVIYVL
STPAHIQIGDIQMRPTEQVT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaggcccggcatggagcggtggcgcgaccggctggcgctggtgacgggggcctcg
gggggcatcggcgcggccgtggcccgggccctggtccagcagggactgaaggtggtgggc
tgcgctcgcaccgtgggcaacatcgaggagctggctgctgaatgtaagagtgcaggctac
cccgggactttgatcccctacagatgtgacctatcaaatgaagaggacatcctctccatg
ttctcagctatccgttctcagcacagcggtgtagacatctgcatcaacaatgctggcttg
gcccggcctgacaccctgctctcaggcagcaccagcggttggaaggacatgttcaatgtg
aacgtgctggcccttagcatctgcacacgggaagcctaccagtccatgaaggagcggaat
gtggacgatggtcacatcattaacatcaatagcatgtctggccaccgagtgttacccctg
tctgtgacccacttctatagtgccaccaagtatgccgtcactgcgctgacagagggactg
aggcaagagcttcgggaggcccagacccacatccgagccacgtgcatctctccaggtgtg
gtggagacacaattcgccttcaaactccacgacaaggaccctgagaaggcagctgccgcc
tatgagcaaatgaagtgtctgaaacccgaggatgtggccgaggctgttatctacgtcctc
agcacccccgcacacatccagattggagacatccagatgaggcccacggagcaggtgacc
tag

DBGET integrated database retrieval system