KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100581806
Entry
100581806         CDS       T03265                                 

Gene name
ANKRD53
Definition
(RefSeq) LOW QUALITY PROTEIN: ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nle03036]
    100581806 (ANKRD53)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100581806 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_4 Ank_3
Other DBs
NCBI-GeneID: 100581806
NCBI-ProteinID: XP_003262578
Ensembl: ENSNLEG00000010246
Position
14
AA seq 530 aa
MASAGSTARRAGSGSWHSERGEGRGARPQPTPRGSMQRAXKVSLKATWTDAESKQPSQPL
PDLADHLRAQATALATPRRPASLTPPRADPSPRGESDQTAIDQTVIWSYYQLFAAAVGNV
EWLRFCLNQSLREIPTDYKGFTAIHFAAQRGKLACLQVLVEEYKFPVDLLTNNSQTPLHL
VIHRDNTTVALPCIYYLLEKGAALNAQTCNGSTPLHLAARDGLLDCVKLLVQSGANVHAQ
DAMGYKPIDFCKMWNHRACARFLKDAMWKKDKKDFAREMRKMKTFMSQLALMEHNYLTEY
QKEHKILSEAAIRKWLHGKLHPGHSLVSNTKQAQATALSKTPEQRGSQRSRSFHPSVEAR
LQCIPQPTEMPKPVYRKPTVKRPTMWNVSNNPARTPTTQISHSQGIRLGVHPDPIPEHDF
SSFLEVRPDGHGGARLHTVDGHWVAPVPRLPFEVLLRMLYPRVWPYRMKVPQGFYPISMR
EVPRKRHLGDNTFWTDTLAMNLRDTFDEAFLAAVRSHQGLPALPSPQTNP
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggcctccgcgggcagcaccgctcggcgggcgggctcgggaagctggcactcagaaagg
ggagaagggagaggtgctcggccgcagccaactccacgtggctccatgcagcgcgcgnac
aaagtctccttgaaggccacctggactgacgcggagtccaagcagcccagccagcccctg
cccgacctcgcagaccacctccgtgcgcaggcgactgccctcgccacgccgcgccgccct
gcctcgctaaccccgccccgcgctgaccccagccccaggggggagtccgaccagacggcg
atcgaccagacggtgatctggagctactaccagctgttcgcggcggctgtgggcaacgtg
gaatggctgcgattctgtctgaaccagagcctcagggaaatccccaccgactacaagggc
ttcactgccatccacttcgccgcccaacggggcaagcttgcatgcctgcaggtcctggta
gaggagtacaagtttcccgtggacctgctgaccaacaatagccagacacccctgcacctc
gtcatccacagggacaacaccaccgtggccctcccctgcatctactacctgctggagaaa
ggtgcagccctcaatgctcagacatgcaacggctccacgcccctgcacctggcagcccgt
gacggcctgctggactgtgtgaagctcctggtgcagagtggcgccaatgtccatgcccaa
gatgccatgggctacaaacccattgacttctgcaaaatgtggaaccaccgtgcctgtgcc
cggttcttgaaggatgccatgtggaaaaaggacaagaaggactttgcccgtgagatgagg
aaaatgaagacgttcatgagccagctggccctcatggagcacaactacctgactgagtat
caaaaagagcacaaaattctcagcgaagctgctatcagaaagtggctccacggcaagctg
cacccaggccactctctggtctctaataccaagcaagcccaggccaccgccctctccaag
accccagagcaacggggatcgcagcgttccaggagcttccacccgtctgtggaggcgcgc
ctgcaatgcattccacagcccacggagatgcccaagcccgtctacaggaagcccacggtc
aagcggcccacgatgtggaatgttagcaacaaccccgccagaacccccaccacccagatc
agccactcgcagggcatccgcctgggcgtgcatccagaccccattccggagcacgacttc
agcagcttcctggaggtgaggcctgatgggcacggcggtgcgcggctgcacacagtggac
ggccactgggtggcgcccgtgccgcggctgccttttgaggtgctgctccgcatgctgtac
ccacgtgtatggccgtacagaatgaaggtgccccagggcttttaccccatcagcatgagg
gaagtgcccaggaagcggcacctgggtgacaacaccttctggactgacactctggccatg
aacctgcgtgacacatttgatgaagccttcctggcagctgtgcgatctcatcaaggactc
cccgccctgccctccccacaaaccaacccataa

DBGET integrated database retrieval system