KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100593557
Entry
100593557         CDS       T03265                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nle03000]
    100593557 (AHRR)
Transcription factors [BR:nle03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100593557 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_4 PAS_3 PAS_9
Other DBs
NCBI-GeneID: 100593557
NCBI-ProteinID: XP_003263236
Ensembl: ENSNLEG00000010815
Position
6
AA seq 697 aa
MIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPGDSRPLAGSAVLEGRLLLESLN
GFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQV
VFGQPPPLETGDDAILGRLLRAQEWGAGAPTEYSAFLTRCFICRVRCLLDSTSGFLTMQF
QGKLKFLFGQKKKAPSGAMLPPRLSLFCIAAPVLLPSAAEMKMRSALLRAKPRADTAATT
DAKVKATTSLCELELHGKPNYSAGRSSRESGVLVLREQTDAGRWAQVPARAPCLCLRGGP
DLVLDPKGGSGDREEEQQRMLSRASGVTGRRETAGPTKALPWTAGKHSEDGARPRLQPSK
NDPPSLRPTPRSSCLPYPCVQGTCRNSPISHPLSPSPSAYSSRTSRPIRDVLEDQVHPPL
CHFPQGSLQHRLPQPGAQRVATRGYPMEDVKLQGIPMPPGDLCGPTLLLDVSIKMEKDSG
SEDAADGCVPSQVWLGASDRSHPATFPTRMHLKTEPDSRQQVYISHQGHSVRGAQPHGRA
TAGRSSELTPFHPAHRACLEPTHGLPQPEPPHQLCARGRGEQSCACRAAEAAPVVKREPL
DSSQWATHSQGAVPGMFPKSALATLVPPQASECTFLP
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgatcccgccgggggagtgcacgtacgcgggccggaagcggaggaggcccctgcagaaa
cagaggcccgccgtgggggcagagaagtccaacccctccaagcggcaccgggaccgcctc
aacgccgaattggaccacctggccagcctgctgccgttcccgcctgacatcatctccaag
cttgacaagctttctgtcctgcgcctcagtgtcagttacctccgggtgaagagcttcttc
caagtcgtgcaggagcagagctcacggcagccggcggccggcgccccctcgcccggagac
agccgtcctcttgcagggtctgccgtgctggagggaaggctgctgttggagtctcttaat
ggctttgctctggtcgtgagtgcagaagggacgatattttatgcgtcagcaacgatcgtg
gactatctgggcttccatcagacggatgtaatgcaccagaacatttacgactacatccat
gtggacgaccgccaggacttctgccggcagctccactgggccatggaccctccccaggtg
gtgtttgggcagcccccgcccttggagacaggagatgacgctatcctggggaggctgctc
agggcccaggagtggggtgcaggcgcgcccaccgagtactcggccttcctgacccgctgc
ttcatctgccgtgtgcgctgcctgctggacagcacctcgggcttcctgacgatgcagttt
caaggaaaactaaaattcctgtttggacagaagaagaaggcgccatcaggagccatgctc
cccccacggctgtcgctgttctgcattgcggcgcccgttctcctcccctccgcagcggag
atgaaaatgaggagcgcgcttctgagggcaaaacccagggcagacaccgcggccaccacg
gatgcaaaagtgaaagccaccaccagtctgtgtgaattggaactgcatggaaaacccaat
tactcagcaggaaggagcagcagagagagcggcgttttggtgctcagggagcagactgac
gctggccgatgggcacaggttcctgccagggccccatgcctgtgcctccggggcggcccc
gaccttgtgctcgaccccaaggggggctcaggggacagggaggaggagcagcagaggatg
ctgagcagggcctctggagtgacagggcggagggagactgcaggacccacaaaggccctg
ccctggacagcgggaaagcacagtgaggatggtgccaggccgaggctgcagcccagcaag
aatgacccaccgtccctgcgccccacgccccgcagctcctgcctgccctacccatgtgtc
cagggcacttgcaggaactcgcccatctctcacccgctgagcccgtcccccagtgcctac
tccagccggacaagcagacccattcgggatgtccttgaggaccaggtacaccctcccctc
tgccactttccccaggggagcctgcagcaccggctccctcagcctggagctcagcgtgtt
gccacgaggggctatcccatggaggacgtgaagctgcaaggtataccgatgcctccgggg
gacctgtgcggtccgacgctgctgctagatgtgtccatcaagatggagaaggactctggg
tctgaggatgctgcagacggctgtgtgcccagccaggtgtggctgggggccagtgacagg
agccatccagccaccttccctaccaggatgcacctgaaaacagaaccagactctcggcaa
caggtgtacatctcgcaccaggggcacagcgtgcggggggctcagccccatgggagggcc
actgctgggcgcagcagcgagctgacccctttccaccctgcacaccgtgcctgcctggag
cccacgcacggccttccccagccagagcctccccaccagctctgtgcacggggccgaggt
gaacagtcctgcgcctgcagagctgctgaggctgcccctgtggtcaagcgggagcccttg
gactcttcccaatgggctactcacagccagggggcggtgcccgggatgtttcccaaaagt
gccttggccacgctggtcccgccccaagcttcggagtgcacattcctgccgtag

DBGET integrated database retrieval system