KEGG   Numida meleagris (helmeted guineafowl): 110403265
Entry
110403265         CDS       T06015                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel04080  Neuroactive ligand-receptor interaction
nmel04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110403265 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110403265 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 110403265
NCBI-ProteinID: XP_021262010
Position
8
AA seq 120 aa
MTGRERGRAGLSPPTNAAIPERGRRLLRVRVPACPCPRAGRSMAARRWLLALLLLLCLAL
SAAYAGPLGAGLDGMDPEDGLIRTLVRPRGARRGNVRRPGGWRKYRRPRPRLSHKGPMPF
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaccgggcgggagcggggccgggccgggctctcaccgcctacaaatgcggcgatcccg
gagcggggccgccgcctcctgcgtgtccgtgtccccgcgtgtccgtgtccccgcgccggg
cggagcatggcggcgcgccgctggctgctggcgctgctgctgctcctctgcctcgcgctg
agcgccgcgtacgcggggccgctgggagcggggctggatgggatggatcccgaggacggc
ctcatccgaacgctggtgcgaccacggggtgcgcggcgcgggaacgtgcggcggccgggg
gggtggcggaaatatcgccgaccccggccacggctgtcccataagggccccatgcccttc
tga

DBGET integrated database retrieval system