KEGG   Nipponia nippon (crested ibis): 104023191
Entry
104023191         CDS       T05756                                 

Gene name
ADAMTS13
Definition
(RefSeq) LOW QUALITY PROTEIN: A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
nni  Nipponia nippon (crested ibis)
Brite
KEGG Orthology (KO) [BR:nni00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nni01002]
    104023191 (ADAMTS13)
Enzymes [BR:nni01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     104023191 (ADAMTS13)
Peptidases and inhibitors [BR:nni01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   104023191 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS ADAM_CR_2 TSP_1 Reprolysin ADAM_spacer1 Reprolysin_4 TSP1_spondin TSP1_CCN Reprolysin_3 Reprolysin_5 Reprolysin_2 Peptidase_M10
Other DBs
NCBI-GeneID: 104023191
NCBI-ProteinID: XP_009475260
Position
Unknown
AA seq 1405 aa
MIVSLTIRALVMLPLGFCWPSAFQEKFLGALDAEDVFSYFGTSSVSDVPEFVVAEPTCPC
KEEQIGLTFCRIQHCSIEAWGELYAFEFLEDHALLSSSFVSNQMVNSSFSLLKRFSGNCF
AGGNPLQPPGAKCRVTYCEGQLQGVIIADEKKIHIKPVRSKDVALLKDLGFSRPHILFRS
AARGENTAKGRFPSRLQKRAEGAVKHLELMVVAGPDVYLYHREDTERYILANLNIGAELL
RDASLGVHFRVHLMQMLVLREPEAEVNITTNITSSLISVCEWSKKVNPQNDSDPQHADIV
LYVTRFDLELPDGNKELRGVTQLGGVCSSFWSCVITQDTGFDLGVTIAHEIGHSLGIPHD
GEGNRCSSSGYIIGXXXXVQQHHNSIDLAWSQCSREEFLAFVSTGQTNCLNDLPDMDGSI
PGWKPGLYYGADEQCKIAFGSVATACTFADSNVDICEVLSCHVQPGDKSSCTRLLVPLLD
GTECGINKWCSKGQCSSLEELNPMAVVHGQWSVWSPFSSCSRSCGGGVVIRQRFCNNPRX
EVGSXXCRGASIQVEMCNTQDCLVTQQEKNMDEQCAATNLNPLYLTVEAPSFYTWTSAVG
FARGDMLCKHMCRAVENEFMVSREDSFVDGTRCEQDDSERHGAFNLCVMGSCRAFGCDGR
MDSEKIMDSCKVCGGDNTTCTKVSGSYAGGKAKEYVTFLSLPYNTTLVHVTNQRPLFTHL
AVKVKGEYVVAGKGKISLNVTYPSVLEDSQIKYKVFLTKDNLPSLEEVHVDGPTQEEIEI
QVYRRYAKEYGSATNPDITFSYFVPKENLTYTWIPQQGPCSVTCGEGTRLVVHVCFDQTK
NETTEDQWCLELPQPLSEHKPCAMEPCLYRWNMSQIDECSAVCGTGVAQQNLTCVQFRDG
LETVVDDSLCPAEEKPLSVVPCVVNVCPLGWDKEEDAHLLQTSESLGHIQLENRTVYVWS
PQAGECSVSCGRGMTQLQYVCVAFDTKEETQEENCHPVPKPESRMEVCDLSPCPPRWKAT
PAGPCSSSCGLGLAVQLVTCVQIRQGKEILLEDRLCPVAEKPLTSVPCVIRMCSYEWSFS
EWTECSTSCGNGIQTRQDFCLNLLTRKHVNPIFCRHFPKAIVVRGCSAGACPEQVVGTGS
HGAGLQTVTPAAHLTTAATAKEARYKDLDLPPSAVPEQAKTGGGVCGKLFLNATGVINMT
GVENSECTVAIGRPLREEITVSILESSLNCTAGEVLLFSGRMMWRTGCRKLPLSLINSRT
NTLIVKQRVFLPGNGVILQYNSRTATKKYYQDCDKQVFGPQGEIVNPVQLPDQRQEVVCR
TFINVAPWHRIAIRALYIDLGPTSNQTHFNYILVRDVSTMKTMVFHGKQQFFWQSTGSQA
EIEFHENVKDHQTSFWAEYRAIEPK
NT seq 4218 nt   +upstreamnt  +downstreamnt
atgattgtcagcttgacgatccgggcgctcgtgatgctccccttggggttctgctggccg
tcagctttccaagagaaatttctcggcgctttggatgcggaagatgttttctcttatttt
ggaaccagctcagtgtctgatgtacccgagtttgttgttgctgagccaacttgcccttgt
aaagaagaacagattgggctgacgttctgtcgtattcaacattgctccattgaggcctgg
ggagaactctatgcctttgaatttctagaggaccatgccctcctttcctcttcctttgtg
agcaatcaaatggtgaactcttcctttagcttactgaagcgattctcaggcaactgcttt
gcaggtggaaatccactgcaacctcccggggcgaagtgtagagtcacttactgtgaaggg
cagctgcaaggagtcatcattgcagatgagaaaaagattcatatcaagcctgtcagaagc
aaagatgtggccctgctgaaggacctcggattctccagaccccacattctcttcagaagt
gctgcaagaggggaaaatacagcaaaagggcggtttccttctcgcctgcagaagagggct
gagggagctgtcaaacatctggagctgatggtcgtagcaggtccagatgtttacttgtac
cacagagaggacacggagcgatatattcttgccaacctgaacattggggcagagctgctg
agagatgcctcactgggtgttcatttcagggttcaccttatgcaaatgcttgttttgaga
gaaccagaggcagaggtaaacatcacaacaaatatcacatcctcgctgatcagcgtttgt
gagtggagcaagaaggtcaacccccagaatgactccgacccccagcatgctgacattgtc
ctctacgtcaccaggtttgacctggagttacctgatgggaacaaggagctacgtggagtg
actcagttaggtggagtctgctcttccttctggagctgtgttattacccaggatactggc
tttgaccttggagtcaccatagcccatgagattgggcacagtcttggaatcccccacgat
ggtgaggggaatcggtgcagcagcagcgggtacatcattgggnnnnnnnnnnnngttcag
cagcaccacaacagcatcgacctcgcctggtcgcagtgcagccgagaagagttcctggcc
tttgtcagcacaggccaaacaaactgcttaaatgacctgccggacatggacggcagcatc
cctggatggaagcctggcttgtactatggagcagatgagcaatgtaaaatagcctttggg
agtgttgccacagcgtgcacctttgctgacagcaatgttgacatatgtgaagttctctca
tgccacgtacaaccgggagacaaatccagctgtactcggcttcttgttcccctcttggat
ggtaccgagtgtggaatcaataagtggtgctccaagggacagtgcagctctctggaagaa
ctgaaccccatggctgtagtccatgggcagtggtccgtctggagccccttctcctcctgc
tcccgcagctgcggaggtggggttgtgataaggcagcggttctgtaacaaccctaggtaa
gaggtggggagcnnnnnntgccgtggtgccagcatccaagtggagatgtgcaatactcag
gactgtttggtgacccagcaggaaaaaaatatggatgaacagtgtgcagcaacaaattta
aacccactgtatctcactgtagaagcgccatccttttatacctggacttctgctgttggc
tttgccagaggagacatgctatgcaagcacatgtgccgggccgtcgaaaacgaattcatg
gtaagccgtgaagacagtttcgtagatggaaccagatgtgagcaggatgactctgagcgc
cacggggctttcaatctgtgtgtaatgggaagctgcagagcgttcgggtgtgatggccgg
atggactccgagaagataatggactcttgcaaagtctgtgggggtgataataccacttgc
accaaagtgagcggatcttacgcaggaggaaaagctaaagagtacgttacgtttctgtcc
ctgccttataacaccaccttggtccatgttaccaatcagagaccactcttcacacatttg
gctgtgaaggttaaaggagagtacgtggttgctggaaaaggaaaaatctcactgaacgtc
acctatccgtcggttctggaggacagccagatcaaatacaaagtgtttctcaccaaggac
aacctgccaagcctggaggaagtccatgtggatgggccaacacaagaagaaattgaaata
caggtctatcgaaggtatgcaaaagaatatggcagtgccaccaacccagacatcaccttc
agctactttgtccccaaagagaatctgacatatacgtggattcctcagcaggggccatgt
tcagtgacctgtggggaagggacacgactagtggttcatgtgtgctttgaccagacaaag
aatgaaacaacagaggatcagtggtgcctggagctcccacagcccctttcagagcacaag
ccctgtgccatggagccatgcctgtacaggtggaacatgtctcagatagatgaatgctct
gctgtctgtggaactggagttgcccagcagaatctgacctgtgttcagtttcgtgatgga
ttggagactgttgtggatgacagcttgtgcccagcagaagaaaaacctctctccgttgtg
ccgtgtgtggttaatgtctgtcctttaggctgggacaaagaggaagatgcacacttactt
cagacttcagagtcacttgggcatatccaactggaaaatcggaccgtgtatgtctggagc
cctcaagctggagagtgttccgtctcctgtggtagaggtatgactcagctacagtatgta
tgtgtggcttttgacaccaaagaagaaacccaagaagaaaactgtcatccagtgccaaag
ccagagagcaggatggaagtctgtgatctcagtccctgcccaccaagatggaaggcaacc
ccagctggcccctgttcctccagctgtgggctcggcttagctgttcagctggtcacctgt
gtgcagattcgccaaggcaaggagattttgctggaggaccgtttgtgtcctgtggcagag
aagccccttaccagcgtcccctgtgtcatccgaatgtgctcttacgaatggagcttcagc
gagtggacagagtgttcaacttcatgtgggaatggcattcagacacggcaggacttctgc
ctcaacctgctaacccgtaagcacgtgaaccccatcttctgtaggcacttccccaaggcc
attgtggtacgtggctgctccgcaggagcctgtcctgagcaggtggtggggactgggtcc
catggagcaggactgcagacagtgacgccagccgcgcatctgacgacagctgccactgcc
aaagaggcaagatacaaggacctggatcttcctccatctgctgtgccagaacaggcaaag
accggtggaggtgtctgtggaaagctctttcttaatgccaccggggtcatcaacatgact
ggtgtagagaacagcgagtgcactgtggccatcggacggcctctcagggaggagataaca
gtcagcatcctggagagctccctcaactgcactgcaggtgaggtattgctgttttctggg
cgaatgatgtggcggacaggctgcaggaagctccctttgtcactgataaattccagaacg
aatacactgattgtgaaacagcgtgttttcctgccaggaaatggagtcattcttcagtac
aacagcagaactgcaactaaaaaatattaccaagactgtgacaagcaggtgtttggtccc
caaggtgaaatagtgaatcctgtgcaactgcctgatcaaaggcaagaggtggtgtgtcgg
accttcatcaatgtggctccttggcatcgcatagctatccgcgccctgtatattgacctg
ggccctaccagcaaccaaacacattttaattacatcctggtccgtgatgtaagcaccatg
aagacgatggtgttccatgggaaacaacaattcttctggcaatcaacagggagccaagct
gaaattgaatttcatgaaaatgttaaggatcaccagaccagtttctgggctgaatatcgt
gctattgagcccaaataa

DBGET integrated database retrieval system