KEGG   Natrinema pellirubrum: Natpe_2590Help
Entry
Natpe_2590        CDS       T02425                                 

Definition
(GenBank) citrate lyase beta subunit
  KO
K19281  beta-methylmalyl-CoA/(S)-malyl-CoA lyase [EC:4.1.3.24]
Organism
npe  Natrinema pellirubrum
Pathway
npe00630  Glyoxylate and dicarboxylate metabolism
npe00660  C5-Branched dibasic acid metabolism
npe01100  Metabolic pathways
npe01120  Microbial metabolism in diverse environments
npe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:npe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Natpe_2590
   00660 C5-Branched dibasic acid metabolism
    Natpe_2590
Enzymes [BR:npe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     Natpe_2590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AGB32398
UniProt: L0JNI3
Position
complement(2525999..2527042)
Genome map
AA seq 347 aa AA seqDB search
MTDDIRLCRTFQTAPAAVPKDDSAKYLVSALEAEGFQAPDWLVPDMEDGTAPNMKAEGLE
NTIEKVPEYDFPGEIWPRVEWSYEDAEYREKGRDQIDQLVAEIGDEIDGVVVPKVGRLED
VERAAEVVAEAESEYGYEDGSIGLSIIIETGRARSDLREIAKFGEDSRLTGLVFGPVDYA
AELGGRDLGDGMPRWDGLLEALSNEASAAGLVSIGGPFDDLFKERAGLTFYNADDYADQV
EHEAQLGLDGSWSLYPKQTLQANTVHMPTPEELERDVSKIERFNAAKAEGTGAVTLDGQM
VDEATFKNFRNTVQQVRAIHEMRPGQTEEYYDEDLLERTLDLELSYE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgacatccgactctgccgtacgttccagactgcaccggccgccgttccaaaa
gacgactccgcgaagtacctcgtctccgcgctcgaggccgagggcttccaggcaccagac
tggctcgtccccgacatggaggacggcaccgcgccgaacatgaaagccgaagggctcgag
aacaccatcgagaaggttcccgagtacgacttccccggcgagatctggccccgcgtcgag
tggagctacgaggacgcggagtaccgcgagaagggccgcgaccagatcgaccagctcgtc
gccgagatcggcgacgagatcgacggcgtcgtcgtccccaaggtcggccgcctcgaggac
gtcgagcgcgccgccgaggtcgtcgccgaggccgagtccgagtacggctacgaggacggc
tccatcggcctctcgatcatcatcgagaccggccgcgcccgctcggatctgcgtgagatc
gccaagttcggcgaggactcccggctcactggactggtcttcggtcccgtcgactacgcc
gccgaactcggcggccgtgacctcggcgacggcatgcctcgctgggacggcctgctcgag
gcgctctcgaacgaggccagcgccgccggcctcgtctcgatcggcggccccttcgacgac
ctgttcaaggaacgggccggcctgacgttctacaacgccgacgactacgcggatcaggtc
gaacacgaggcccagctcgggctcgacggctcctggtcgctctatcccaaacagaccctg
caggcaaacaccgtccacatgcccacgcccgaggaactcgagcgcgacgtgagcaagatc
gagcgcttcaacgcggccaaggccgaggggaccggcgcggtcaccctcgacggccagatg
gtcgacgaggccacgttcaagaacttccgtaacacggtccagcaggtccgcgcgatccac
gagatgcgacccggccagaccgaggagtactacgacgaggacctcctcgagcgcacgctc
gatctcgagctgtcctacgaatag

DBGET integrated database retrieval system