KEGG   Novosphingobium sp. PP1Y: PP1Y_AT2691
Entry
PP1Y_AT2691       CDS       T01515                                 
Name
(GenBank) type IV secretion system protein VirB4
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:npp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PP1Y_AT2691
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:npp02044]
    PP1Y_AT2691
Enzymes [BR:npp01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     PP1Y_AT2691
Secretion system [BR:npp02044]
 Type IV secretion system
  Trb secretion system protein
   PP1Y_AT2691
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB AAA_10 AAA_22 TraG-D_C ABC_tran HerA_C AAA_29 DUF87 FtsK_SpoIIIE YvrJ
Other DBs
NCBI-ProteinID: CCA91239
UniProt: F6IGH3
Position
284842..287298
AA seq 818 aa
MMSLQEYRTKSASLADFLPWVALVGPGVVLNKDGSFQRTARFRGPDLDSATPAELVAVTS
RLNNALRRLGSGWAVFVEAQRTAAQAYPQSRFPDPVSALVDRERREQFREEGAHFESGYY
LTLLWMPPPEEAARAEGWLYEGKASTGVDPKELVKSFADRTDRVLHLVEGFMPEAAWLDD
AATLTYLHSTVSTRTQRVRVPETPVYLDALLADEPLTGGLEPMLGAHHLRTLTITGFPTA
TFPGLLDELNRQAFPYRWSTRAIMLDKTDATKLLSKIRRQWFAKRKSVAAILKEVMTNEQ
SVLMDSDASNKAADADMALQELGADHAGIAYVTATLTVWDRVPALAAEKLRLVEKVIQGR
DFTCTIEGMNALEAWLGSLPGHVYANVRQPPISTLNLAHLIPLSAVWAGAERDEHFGDAP
LLYGKTEGSTPFRLSLHVGDVGHSLIVGPTGAGKSVLLALMALQFRRYKGSQIFAFDFGG
SIRAAALGMGGDWQDLGGALHAEEGDSDAVALQPLARIDNAGERAWAAEWLAAMLAGEGM
VIDPAAKEHLWSALTSLASAPPAERTLTGLAVLLQSQELKQALAPYLIGGPWGRLLDAEQ
EHLGEASVQAFETEGLIGATSAAAVLAYLFHRIEGRLDGSPTIIIIDEGWLVLDSPAFAA
QLREWLKTLRKKNASVIFATQSLADIETSAIAPAIIESCPTRIFLPNERAAEPQIARVYE
RFGLNDRQIEILSRATPKRDYYCQSRRGNRLFELGLGDVALAFSAASSKTDQIRIAELVA
AHGREGFAAAWLHNRSLAWAAELLPPPPPALTDKENRP
NT seq 2457 nt   +upstreamnt  +downstreamnt
atgatgtcgcttcaggaatatcggaccaaatccgccagtctcgcagacttcctcccctgg
gtcgcactggtggggccgggcgtggtgctcaacaaggacggatcgttccagcggacagcg
cgctttcgcggtcccgatctcgacagtgccacgcccgccgaactcgtggccgtcacctcc
cgtctcaacaacgccctgcggcggttgggttcaggatgggcggttttcgtcgaagcgcag
cgcaccgcggcgcaagcctatccgcaatcccgctttcccgatcctgtctcggcactggtc
gacagggagcgccgcgaacagtttcgtgaggaaggcgcgcacttcgaaagcggctattat
ctgacgctgctgtggatgccgccgcccgaggaagccgcgcgcgccgaaggctggctctac
gaaggcaaggcgtcgaccggggtcgatcccaaggaactcgtcaaatccttcgccgatcgt
accgaccgcgtgctgcatctggttgagggatttatgcccgaggcagcgtggctcgatgac
gctgccacgctgacctatctccacagcacggtatcgaccaggacgcagcgcgttcgcgtg
cccgaaacgccggtctatctcgacgcgctgctggccgatgagccgctgactggcgggctt
gagcccatgctcggcgcccatcatttgcgcacgctcacgatcaccggctttccgacggcg
acctttcccgggctgcttgatgagctgaaccggcaagccttcccgtaccgctggtcgacg
cgggcaatcatgctcgacaagaccgatgccaccaagctgctctcgaaaattcggcggcaa
tggttcgccaagcgcaaatcggtcgccgccatactcaaggaggtgatgactaacgagcag
tcagtgctgatggattcggacgcttcgaacaaggcggccgatgccgacatggcgctgcag
gagcttggcgcagatcatgccggcattgcttatgtcactgcgacgctcacggtctgggac
cgcgtcccggcgctggcggcggagaaactaaggctggtcgaaaaggtcatccaaggccgc
gacttcacctgcacgatcgaaggcatgaatgcgctcgaggcatggctcggatcgcttccc
ggccatgtctacgccaatgtccggcagccgcccatttccacactcaatctcgcccacctg
atccccctgtcagcggtatgggcgggagcggaacgggacgagcatttcggtgacgccccc
ttgctttacggcaagaccgaaggctcgaccccgttccgcctttctcttcatgtcggcgat
gtcggccacagtctgatcgtcggcccgacaggggcaggcaaatccgtgctgctggcgctg
atggcgctgcaattccggcgctacaaaggcagccagatcttcgccttcgattttggtgga
tcgatccgcgctgccgcgctcggcatgggcggcgactggcaggatctcggaggcgctctg
catgccgaggaaggcgacagcgatgctgtcgccctgcagccgcttgcaaggatcgacaac
gccggtgaacgcgcctgggccgccgaatggctggcggcgatgctggccggggaaggcatg
gtgattgaccctgccgccaaagagcatctctggtcggccctgacatcgcttgcgtccgca
ccacctgccgagcgcacactcaccggtctcgcggtcctcctgcaatcccaggaattgaag
caggcactagccccatatctcattggcggtccatggggacggctgctcgatgccgaacag
gaacatctgggcgaggcctctgtgcaggctttcgaaaccgaaggtctgattggcgcaaca
tcggccgcggctgtgctcgcctacctgttccaccggatcgaagggcggctcgacggctcg
ccgaccataatcatcatcgatgaaggctggctcgtgctcgacagcccggccttcgccgcg
cagctgcgcgaatggctgaagacgctgcgcaagaagaatgcgagcgtcatcttcgcgacc
cagagccttgccgacatcgagacgtcggccatcgcgcctgccatcatcgaaagctgcccg
acgcgcatctttctgcccaacgagcgcgcggccgaaccgcagatcgcacgggtctatgag
cggttcggcctcaatgatcgccagatcgaaatcctgagccgggctaccccgaaacgcgat
tattactgtcaatcgcgacgcggcaaccggctattcgagctgggcctgggcgatgtcgca
ctcgccttcagcgccgcctcttccaaaaccgatcagatccgtatcgccgagcttgtcgca
gcccatggccgcgaaggctttgcagcggcctggctccataaccgcagcctcgcatgggcg
gccgagctgcttcctcccccgccgcccgcactaacggacaaggaaaaccgcccatga

DBGET integrated database retrieval system