KEGG   Novosphingobium sp. PP1Y: PP1Y_AT31250
Entry
PP1Y_AT31250      CDS       T01515                                 

Definition
(GenBank) dihydrodipicolinate synthetase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00626  Naphthalene degradation
npp01100  Metabolic pathways
npp01120  Microbial metabolism in diverse environments
npp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:npp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    PP1Y_AT31250
Enzymes [BR:npp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     PP1Y_AT31250
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: CCA93880
UniProt: F6IH36
Position
complement(3285173..3286174)
AA seq 333 aa
MAKTLLSATDVKGAWAIIPTPSKDNASDWRATKTVDLDETARVVNGLIDAGIDGILSMGT
LGEAATMTHDEKLDFMRALIDAAAGRVPVFVGTTCINTRDTVALTREALALGADGTMLGV
PMWCAPSLDVAVQFYKDVAEAVPEMNIAIYANPEAFKFDFPRAFWAQVAEIPQVVTAKYI
GVANLLPDLAAIRGRIKLLPIDFDYYGAARMDDSVDAFWSSGAVCHPLVTTTLRDLVAQA
RATGDWSAAKAFMGRLGPTAAPLFPNGSFKEFSTYNIALEKARMDAGGWMKAGPVRPPYH
LCPEPYLAGARKSGQMWAELGKALEAEALGAAA
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggcaaagactttgttgagcgccaccgatgtcaagggcgcttgggcaatcattccgacc
ccgtccaaggataacgcgtcagactggcgtgcgaccaaaaccgtcgatctcgatgaaacc
gctcgcgtggtcaacgggctgatcgatgccggaatcgacggcatcctgagcatgggaacg
ctgggcgaagccgcgaccatgacccatgacgaaaagctggacttcatgcgtgcactgatc
gacgcggcggccggtcgggttccggtcttcgtcggcacgacctgcatcaacacccgcgat
acggtggcgctgacgcgggaagcgctcgcgctcggtgccgacggcacgatgcttggcgtg
ccgatgtggtgcgcgcccagcctcgacgtcgctgtccaattctacaaggatgttgccgag
gccgtgccggaaatgaacatcgcgatctatgcgaacccggaagccttcaaattcgatttc
ccgcgtgcgttctgggcccaggtggctgaaattcctcaggtcgtgaccgccaaatatatc
ggcgtcgccaacctcttgcccgacctggccgcgatccgcggtcggatcaagctgctgccg
atcgacttcgactattatggcgcggcgcggatggatgattcggtcgacgctttctggtcg
agcggagcggtctgccacccgctggtgacgaccaccctgcgcgacctggtcgcccaggcc
cgcgcaaccggcgactggagcgcggccaaggcgttcatgggccgcctcggcccgaccgca
gcccccttgttcccgaacggcagcttcaaggaattctcgacctacaacattgcgcttgaa
aaggcgcggatggacgccggtggctggatgaaggccggacctgtgcgtccgccctaccat
ctctgtccggagccctatctggcgggcgcgcgcaagtccggtcagatgtgggccgaactg
ggcaaagcgctcgaagccgaagcattgggcgctgctgcctag

DBGET integrated database retrieval system