KEGG   Nanorana parkeri: 108796039Help
Entry
108796039         CDS       T04897                                 

Gene name
CACNA1I
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I
Organism
npr  Nanorana parkeri
Pathway
npr04010  MAPK signaling pathway
npr04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108796039 (CACNA1I)
   04020 Calcium signaling pathway
    108796039 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 108796039
NCBI-ProteinID: XP_018422918
Position
Unknown
AA seq 1591 aa AA seqDB search
MEMRERDYRETTKFKNLFFFKCLMPKVLFDEETVDQLIMEAKLLLGLIHTALQPEELTNI
LEISNIVFTSMFALEMMLKLSAFGFFEYLRNPYNIFDGIIVIISVWEIIGQNDGGLSVLR
TFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLR
TDSGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAALYFVALMTFGNY
VLFNLLVAILVEGFQAEGDANRSYSDEERSSLNIEESDKYHEIQAGSDPKLCTAPVTPNG
HLESTPIISQQITGGVMNTSKNSLQRDQVLVALDCRKSSVMSLGRMTYDQRSQVGSRPPH
WNRSGAWGSRRSSWNSLGRRTSIRPRPCTAEHESLLSRAEFHRDRSHSRRASSLKHRRAM
SLDNKGSTDIPEHSGLHTSHRTPSKGTNSVGEYQDSSVKTPQIMKDVFPKMNNRKDKDEE
EEEIDYSLCFRIRKMIEVYRPDWCALREDWSIFLFSPQNRFRMMCQTIIAHKLFDYVVLA
FIFLNCITIALERPQIEHKSTERMFLSISNYIFTAIFVAEMTLKVVSLGFYFGGRAYLRS
SWNILDGFLVLVSMIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVET
LISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFFYCLGVDVRNVTNKSDCEAANYKWVH
HKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVSVDQQPITNHNPWMLLYFISFLLIV
SFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCPARL
LIHSVCTSHYLDIFITIIICLNVITMSLEHYSQPKSLEIALKYCNYMFTTVFVLEAVLKL
TAFGFRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRITRVLKL
LKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNADHPCEGMSRH
ATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTSDDRSCLSNLQFISPLYFVSFVLTAQ
FVLINVVVAVLMKHLDDSNKEAQEDAELDAEIELELAHGLCSQASPVSALDNGGRGGRPA
TEGHRSLRCFSPAQENLWLDSVSLIIKDTFEGELMIIDNLSGSVFHHYSSPAVCEKCNHD
KHEVQLAEMEAFSLTSDKSSSVLTDDLSSEDQGVTSQLKEMKLGRDPPEHGVWGENVFPH
SSLKGSPDSEQYLCEIDKISLTPAESWDSWLKEESNPASPPQPPLLGDPLIPLLPIPAEF
FHPAIPTTEKDPEDLALQKSIPKLSSPESWATLHSPDVKCSLHRQPTESNSSMESGSASS
EDSLQTTLEDSLNLSDSPQCTMDLPDLRVSPTTHHTTLPISSLSIMQRRSNRPSFALQKV
RRHQRSHSSGGSTSPGCTLHDSMDPSDEEGAGGSLRGTSEPSETLSSLSLTSLFSPPPSL
APPGGAIKKCSSVNSLSVAPSRVRGAKQFYAVDPQGFLSMPSWVMDFYQTSIPSENQENR
SSTGKLPTERGIPTGSVSGNVAFGNNNRRNR
NT seq 4776 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgagagagagagactaccgagagactaccaagttcaagaatctgtttttcttc
aaatgcttaatgcccaaagttctgtttgatgaggaaactgtggaccagcttataatggaa
gcaaaattacttttaggcctcattcacactgccctacagcctgaagaactcaccaacatt
ctggagataagtaatattgtattcaccagcatgtttgctctggaaatgatgctcaaactt
tcagcttttggattttttgaatatctccgaaatccatataatatctttgatggaattata
gtcattataagtgtctgggagattatcggacagaacgatggtgggctttcagttttaaga
acttttcgccttctgcgagtgttgaaactcgtacggtttatgcctgcactgagacggcag
ctggtagtattaatgaagacgatggacaatgtggctacattttgcatgctcctcatgctc
tttatcttcatctttagtattcttggaatgcatatttttggatgtaaattcagcctaagg
acagattccggagacactgtacctgatcggaaaaactttgactctctactgtgggctatt
gtaacagtcttccagatcctgacccaggaagactggaacgtggtactttataatggcatg
gccagtacatctccatgggcagctctctactttgtggctctcatgacatttggaaattat
gttctcttcaatcttctggttgccattttggtagaaggattccaagcagagggggatgct
aaccggtcttattctgatgaagaaagaagctctttaaatattgaagagtctgataaatat
catgaaattcaggctgggtctgatccaaagctttgtacagctccagtgacaccaaatgga
catctggaaagcacccctataataagtcaacagatcactggtggagtcatgaatacgtct
aaaaattctctacaaagggatcaagtactggtagctctggactgcaggaaaagcagtgta
atgtctctcggtcgtatgacctatgatcagaggtcacaggtaggttcacggccacctcac
tggaacagaagtggagcttggggcagccgcagatcaagctggaacagcttgggtcgtcgc
acaagtattaggccaagaccatgtacagctgagcatgagtctttactctctagagcagag
ttccacagagacagaagtcattccaggagagcatccagcctgaaacacaggagagcaatg
tcgctggacaataagggctctacagacattccagaacattctggacttcatacaagccat
aggacacccagcaaagggactaattcagttggagaatatcaagattccagtgtaaaaact
ccccagatcatgaaggatgttttccccaagatgaacaaccgtaaggataaggatgaagaa
gaagaggaaattgattatagtttatgtttccgaatcagaaaaatgattgaggtttaccga
ccggattggtgtgcattacgtgaagactggtcaatattccttttctctcctcagaacagg
ttccgcatgatgtgtcaaacgattattgcacacaagctttttgactacgtggtacttgca
tttatttttctcaactgcatcaccattgctttggaaaggcctcagattgagcacaagagt
acggagaggatgttcctcagcatatcaaactatatttttactgctatctttgtagctgag
atgacattgaaggtggtctccttaggattttattttggaggcagggcatatctccgcagc
agctggaacattctagatggtttccttgtcttggtatcaatgattgatattgtggtgtct
gtagcatctgctggaggagccaaaattcttggtgttctgagggtgctgcgacttctacga
acattacggcctctaagagtaatcagcagagctccaggcctgaaactggtggtggaaacc
ttaatatcttctttgaaaccaatcggaaatattgtcctgatttgttgtgccttcttcatt
atttttgggatccttggggtgcagctttttaaaggtaaatttttctactgccttggtgta
gatgttcgaaatgttaccaacaagtcagactgtgaggctgccaattataaatgggttcat
cacaagtacaacttcgataatctagggcaggctttaatgtcactttttgttttggcatca
aaagacggatgggttaatattatgtataatggtcttgatgcagtctctgtggaccagcag
cccattaccaatcacaacccgtggatgttgctgtattttatctccttcctacttattgtt
agtttctttgtactcaacatgtttgtgggtgtagtagtagagaatttccataagtgccgc
caacatcaagaagcagaggaagcccgaagacgagaggaaaagcgcctgagacgcttggaa
aaaaaaagaaggaaagcccagcgtctgccatattatgccacctactgccctgcgcgcctc
ttaattcactccgtctgcacaagtcattacttggatattttcattacgatcatcatttgc
cttaatgttatcacaatgtccttggagcactacagccaaccaaagtctcttgaaattgct
ctgaagtactgcaactacatgtttactacagtctttgtacttgaagctgtgctgaaactg
acagcctttggatttcgaagatttttcaaggacaggtggaaccagctggatctggccatt
gtgctcctttctgtaatgggaatcactttggaagaaatagaaatcaatgcagctttgccc
atcaatcctaccattatccgcattatgagagtgctgcgcatcactagagtgctgaagctg
ctgaaaatggcaacaggcatgagggcattactggacactgtcgtacaagctctcccacag
gtaggaaacctgggccttctcttcatgcttctcttctttatttatgcagctcttggagta
gagctgtttggtaaacttgtttgcaatgctgatcatccttgtgagggaatgagccgccac
gccacctttgaaaactttgggatggccttcttgactctctttcaggtttctactggagat
aattggaatggaataatgaaggacacactacgtgactgcaccagtgatgaccgcagctgc
ttgagcaacctgcagttcatctcacctctttactttgtcagttttgtgctcacagcccag
tttgtactaataaatgtagtggttgctgtattaatgaagcacctggatgacagcaataaa
gaagcacaggaggatgcagagctggatgctgagattgagttggagttagctcacggactt
tgttctcaggcatcacctgtgtctgctttagataatgggggacgtggaggaagaccagcc
acagaagggcatcgtagtttaagatgtttttctccagcccaggagaacttgtggcttgac
agtgtttcattgataattaaagacacattcgaaggggaattgatgataattgacaattta
tctggatcggttttccatcactattcttcaccagcagtgtgtgaaaaatgtaaccacgac
aagcatgaggtccagctggcagaaatggaggccttttctttaacctctgacaagtcctct
tcagtactgacagatgatctcagttcagaagatcaaggtgtcacaagtcagttaaaggag
atgaagctagggagggacccaccagagcatggtgtgtggggtgagaatgtttttccccat
agttctcttaagggtagtccagactctgaacaatacttatgtgagatagacaagatctca
ttaaccccagcagagtcttgggacagctggctaaaagaagaaagcaacccagcatcccct
ccacaacctcctttgttaggagatccattgattcctttgttaccaatccctgctgagttc
ttccatcctgccatccctactacagaaaaggatccagaggatctggcactccaaaaaagt
atccctaaactttcttctcctgagtcttgggctactcttcattccccagatgtcaaatgt
tcacttcatagacagccaacagaaagcaattcatcaatggaaagtggaagtgcaagttct
gaggacagcttacagactactcttgaggatagcttgaatctaagcgactctccgcagtgc
accatggacctccctgatctgcgtgtatctcctacaacccatcatactacccttcctata
tcttctctttcaattatgcagaggaggagcaaccgtcctagctttgcacttcagaaggtt
cgacgccaccaacggagccatagcagtggtggcagcactagtcctggatgtactcttcat
gactccatggacccttctgatgaagaaggtgctggtggaagtcttagaggaacaagtgag
ccttcagagactcttagtagcttatcattaacatctctgttttcacccccaccctcctta
gcaccacctgggggtgccataaaaaaatgcagcagcgtaaacagtctttctgttgccccc
tctagggtaagaggagcaaagcagttttacgcagtcgatccacagggcttcctttcaatg
ccatcatgggtgatggatttttaccaaacttctattccctcagaaaaccaagaaaaccgt
agtagtactggaaaactgccaactgaaagagggatacctactggtagtgtctcaggaaat
gtggcctttggcaataataataggcggaacagatga

DBGET integrated database retrieval system