KEGG   Natranaerobius thermophilus: Nther_2476
Entry
Nther_2476        CDS       T00761                                 

Name
(GenBank) Formate C-acetyltransferase
  KO
K23121  trans-4-hydroxy-L-proline dehydratase [EC:4.2.1.172]
Organism
nth  Natranaerobius thermophilus
Pathway
nth00330  Arginine and proline metabolism
nth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nth00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Nther_2476
Enzymes [BR:nth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.172  trans-4-hydroxy-L-proline dehydratase
     Nther_2476
SSDB
Motif
Pfam: PFL-like Gly_radical Sigma70_r2
Other DBs
NCBI-ProteinID: ACB86039
UniProt: B2A1A1
Position
complement(2661735..2664125)
AA seq 796 aa
MENNSRNSESMSPRVKKLREQSVSKNPKVSVERAILVTQAYKKYDGNVSIPILRALTFKH
ILENKSISINDGELIVGERGPAPQEVPTYPELCTHSITDLEIIHDREKVFFEVDETVKKI
QDSDIIPFWKGKSMREKIFDNMSREWLDCYEAGIFTEFMEQRAPGHTVADGKIYQKGLLD
FRDDIDLELKNIDEINDPQAYEKSEQLKAMRVCIDALIEFAQRYANIAEELAQEVDDSHR
KEELLKIAEICKRVPAKAPRNFWEALQYYWFVHLGVITELNTWDSFCPGRLDQHLYPFYL
QDLNAGELTRGSAKELLQCFWIKFNNQPAPPKVGTTLKESGTYTDFCNINIGGVTPEGFD
GVNDVSYLLLEVIDEMQLVQPSTNIQVSKQNPNEFIKEAGKIIRKGWGQPSVFNTDAVIS
ELLNQGKDLVDARCGGTSGCVEAGTFGKESYILTGYFNLTKILELTLYRGVDPRSGKQIG
LKTDDPETFDSFQDLIDAFNEQLNYFIDIKIRGNNIIEKLYDKYMPSPFLSVIIDDCIKK
AKDYNSGGARYNTRYIQGVGIGTITDSLSAIKHHIFEKQNYTWNELLTALQNNFEGFKQM
RGFLKNKTPRYGNDDDSADDLMKEVFQRFYDAVNGRKTMTGGTYRINMLPTTCHVYFGSV
IGATPEGRLRGTPLSEGISPVQSADQEGPTAALKSAAKMDHIKTGGTLLNLKFTPQVLQG
EEGLLNLVYLVRSYFRMNGHHVQFNVVDAETLKDAQRNPDSYRNLIVRVAGYSDYFNNLN
ENLQNEIIKRTEHSIG
NT seq 2391 nt   +upstreamnt  +downstreamnt
atggaaaataatagtaggaattctgaaagcatgagtccccgtgttaaaaaactcagggaa
caaagtgtctctaagaatcctaaagtatcggtagaacgcgctatacttgtaacccaggcc
tacaaaaaatatgatggcaatgtgtcaattcccatattgagagctttaacatttaaacac
attttagaaaataagagtatttctattaatgatggagaattgattgtgggagaacgagga
ccagcacctcaagaagtaccaacttatcccgaactttgtacccattccatcactgattta
gagataattcatgacagggaaaaagttttttttgaggtcgacgaaactgttaaaaaaata
caggacagcgatatcattcctttttggaaaggaaagtccatgagagaaaagatatttgat
aatatgagccgagaatggcttgactgttatgaagcggggatctttacagaatttatggaa
caaagagctcctggacacacagtagctgatgggaaaatatatcagaagggtttattggat
tttagggatgatatcgacttagaacttaaaaatattgatgaaataaatgatcctcaagct
tacgaaaaaagtgaacagttaaaagctatgcgtgtttgtattgatgcccttatagaattt
gcccaaagatatgcaaatatagctgaagagttagcacaagaagtagatgatagccatcga
aaagaagagttgttaaagatagcagaaatatgtaaacgtgttccggcaaaagcgccgcgt
aatttttgggaagcactacaatattactggtttgtgcatctaggtgtgataacggaattg
aatacatgggattccttttgccctggtagactggatcaacatttgtatccattttattta
caagatttaaatgcaggagagttgacaaggggttcagctaaagaattgttgcagtgcttt
tggataaaattcaacaatcaaccagctccacctaaagtgggtaccacattgaaagaaagc
ggtacttacacagacttttgtaatatcaatatcggaggagtgacacctgaaggttttgat
ggcgtcaatgatgtaagttacttacttttagaagtaatagatgaaatgcagttggttcaa
ccaagtaccaacatacaggttagtaaacaaaatcccaacgaatttattaaagaagccgga
aaaatcatcagaaaagggtgggggcaaccctcagtatttaatactgatgcagtcatatct
gaactattgaatcaggggaaggacttggttgatgccagatgtggcggcactagtggttgt
gtagaagcggggaccttcggaaaagaaagttatattttaaccggatactttaatttaacc
aaaatactggaattaaccttgtatagaggcgttgatcccagatccggaaagcaaattgga
ctaaaaacagatgatcctgaaacctttgatagttttcaagatttaatagatgcctttaat
gaacaattgaattattttatagatataaaaatccgagggaacaacatcatagaaaaacta
tatgataaatatatgccgtcaccttttctttcagtcataatcgatgattgtatcaaaaaa
gccaaagactataattctggtggggcaaggtataatacaagatatattcaaggtgttggg
atagggacaattaccgatagtttgtctgccataaaacaccacatttttgaaaaacagaat
tacacgtggaatgagctgttaacagctttacaaaacaactttgaaggctttaaacagatg
agaggatttttgaaaaacaaaacacccaggtacggtaatgacgacgactctgcagatgat
ttgatgaaggaagttttccaaaggttctacgatgcagtgaatggtcgtaaaactatgacc
ggaggtacttatagaataaatatgctgcccactacttgccatgtttactttggatcagtt
atcggcgcaacccccgaaggaagattgaggggaactccactttctgaaggtatatcaccg
gttcaaagcgcagatcaggaaggacctactgctgccttgaaatctgccgcaaaaatggac
catataaaaactggtggaactttgttaaatcttaaatttactcctcaagtattacaaggg
gaggaaggccttttaaacttggtttatttggttaggtcctatttccgtatgaatgggcat
catgttcagttcaatgttgtagatgccgaaacattaaaggatgctcaaagaaatcccgat
tcatatcggaacttaattgtccgagtggcaggttacagtgattatttcaataacttaaac
gaaaacttacaaaatgagattattaaaagaacagaacattccataggttga

DBGET integrated database retrieval system