KEGG   Nematostella vectensis (sea anemone): 116604351
Entry
116604351         CDS       T01037                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 53-like
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
nve  Nematostella vectensis (sea anemone)
Brite
KEGG Orthology (KO) [BR:nve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nve03036]
    116604351
Chromosome and associated proteins [BR:nve03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    116604351
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3
Other DBs
NCBI-GeneID: 116604351
NCBI-ProteinID: XP_032222478
Position
Unknown
AA seq 347 aa
MAAGFTQRRRRKQSVAPDKPDIDDDVLLASAIGDVTWLQQSLWNAKKVYKQTKQHGFAPI
HLAAKNGHLESLQVMVERYKVDINLPSETGWTPLHLAINTTNKKKSLKCVQYLLVNGADP
SRQTHDGTTPVHRAAIEGHVKCLQLLIRAGGDIEREDNEHNTPMDLARVWGHRPCARILS
NHQWYLDKEKERIKKLEEEIKEQELAAEIQRLSLIKKMEGQHESQLAFKRWLGFKGFPDL
PSMYGPVPLEERRAFEALKASKSVPNTPRGFKGESMFVVKSKSDTEGFHGAIRQHRTSDH
DKKLSLIPLERISASRRHRSQRQKVISQNKAPRMANLFSPPVPLTSR
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggcggccggattcactcaaagaagaagacgaaagcagtcggtagctcccgataaaccg
gacatagatgacgatgtgttgcttgcttctgctataggagatgttacttggctacagcaa
agtctatggaacgcgaaaaaagtttacaagcaaacaaaacagcatggatttgcaccaata
cacttggcagctaaaaatggccaccttgagagtctgcaagtgatggtggagcggtacaag
gttgatataaacttaccaagtgaaacaggctggaccccacttcaccttgctattaataca
acgaacaagaaaaagtccttgaagtgtgtgcagtacttgctggtaaacggtgcagatcca
tccagacaaacccatgatggcaccacaccagtgcacagagctgccatcgaaggccatgtg
aaatgtctacagcttttgataagggctggtggtgacatagagagagaagacaatgagcac
aatactcccatggatctagcaagagtgtggggacacaggccctgtgcacggatactttct
aaccatcagtggtacttggacaaagagaaagaaagaataaaaaagcttgaggaagagatc
aaggagcaagaacttgctgcagaaatacagagacttagtctaataaaaaagatggaagga
caacatgaaagccaattggcatttaaaaggtggttaggttttaaaggatttcctgattta
ccaagcatgtatggcccagtgccactggaggagaggcgagcatttgaggctttgaaagcg
agcaaatcagtaccaaacacacccaggggttttaagggagagtcaatgtttgttgttaaa
tctaaaagtgacaccgaaggatttcatggtgcaatcagacagcacagaacttctgatcat
gacaaaaaacttagtcttattccacttgaaagaatctcagcatcaagacgacatagatca
caaagacagaaggttataagtcagaataaggctcctcgcatggcaaacttattctcccca
cctgtccccttaacctcccgctga

DBGET integrated database retrieval system