KEGG   Nasonia vitripennis (jewel wasp): 100115613
Entry
100115613         CDS       T01081                                 

Name
(RefSeq) probable DNA mismatch repair protein Msh6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    100115613
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nvi03400]
    100115613
DNA repair and recombination proteins [BR:nvi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     100115613
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_IV MutS_II CIMR
Other DBs
NCBI-GeneID: 100115613
NCBI-ProteinID: XP_001600292
NASONIABASE: NV14233
UniProt: A0A7M7GB18
Position
3
AA seq 1151 aa
MPKVNTLFNYFTSPKGASPRSNNSSPAPKPRASKAKSETPKREQKNKDTKRGKGKDKENV
RENQERKRSLDDLDDDEEPKESEEAVTPKPTPKRRRIIIPEDNSEDSGDEYKPDESAESE
EDLDLSVVSESEPNTASEDEDETPKKKQKMSNIKTPSRRGGGAKKSIAKKDSGTGQEQPT
GKASDTQDWPHLKYEFLQKDKIRDNKKRRSTDPDYDPRTVYVPPDFLDKQTPAMRQWWVL
KSDHYDCVLFFKVGKFYELYHMDAVTGVNELSLTFMRGEFAHSGFPEIAYGRFSASLIER
GYKVARIEQTENPEMMSQRCAKMGKTTKFDKVVKREICQISTKGTRVYTAQDAEASAPTS
TYLLSIIEKQERNQNISSYGVCFIDTTIGDFNLGQFQDDRCNSRLLTLLAHYPPAHVIYE
RNNLSQTTLKILNNLLPGAMKEALQKEVQFWSSTKVLNVLHEADYFKNEEDSSFSWPKGL
EPYLNDGDSLGLTPLEEKQLAVNALGGCVYLLKNYQLDHQLLAQGRFKTYVPPDFSVNAE
KSDGTKLAYNMVLDAMTITNLRVLGNEGSLIKTLDNCCTAFGKRLLREWVCRPSCRKSVI
VERQNAITELIDNPDVVQEVRSKLSGLPDLERLLSKIHVQGNAAKLRNHPDGRAIMFEGP
AYSKKTIVDFITALNGFEDILKLIKKFSKFTNPLINKCTQLEPEGDFPELRETLDHFKTA
FNHEEAKKEGFIVPKHGVDREYDAVLMELADIKKELDSYLEKQRKHFGVQIKFCGNDKKR
FQIEVPESQIKKVGSGYELQGSRKGFKRYYTEESKDLLARQIAAEEQKDKVLKDSNRKIF
AKFSDQYDKWSNATYNIAVLDCLISLAEYARTCVTCIPTIFDDTDDQGIFIEIREGKHPC
IVSENFIPNDTVIATAEAAPLIILTGPNMGGKSTLMRQVGLITIMAQIGCHVPATDCNLT
LVDRIFTRLGANDDIMAGQSTFLVELSETSAILQHATKYSLVLLDELGRGTSTYDGTAIA
ASVVEALTKIQCRTLFSTHYHTLVEDYKMNKNVTLAHMACMVESDDEDQISEENVTFLYK
LSEGACPKSYGFNAARLAGVPASITKRAQSIATKLEAEVNLRHAFTALCKITDSTAVKPL
FQKGFEFLSKC
NT seq 3456 nt   +upstreamnt  +downstreamnt
atgccgaaggtgaatacgctgttcaactatttcacctcgccgaagggagcctcaccgaga
tcgaacaactcctcaccggcgccgaagcccagggcgtccaaggcgaaatccgagactccg
aagagggaacaaaagaacaaagatactaagagaggcaaaggcaaagacaaggagaacgtt
cgagagaatcaagagagaaaaaggtctttggatgatctcgatgacgatgaggaaccaaag
gagagcgaggaagctgttacaccgaagcctactcccaagagaaggagaatcatcattcca
gaagataatagtgaggattccggtgatgaatacaagcctgatgagtccgctgaatctgaa
gaggatttggatctttcagtggtcagcgaaagtgaacccaatactgcttcggaagatgag
gatgaaacaccaaagaaaaaacagaaaatgtccaatattaagacaccatccagaagaggt
ggtggtgctaaaaagtcaatcgctaaaaaagattcaggaactggtcaagagcaacccact
ggaaaagcatcagacacacaggattggccccatttaaagtatgaatttttgcagaaagat
aagatcagagataacaaaaaacgtcgatccactgaccctgattatgatccaagaactgtc
tatgtgcctccagactttttggataagcaaacacctgccatgcgtcagtggtgggttttg
aaatctgatcattatgactgcgtattattcttcaaagtgggcaaattttatgaattgtac
cacatggatgctgtgactggagtcaatgagctcagtttaacattcatgagaggagaattc
gcgcattctggctttccagaaattgcttatggacgattttctgcaagtctaattgaaaga
ggttacaaggttgcaagaattgaacaaacagaaaatccagaaatgatgagtcaacgatgc
gctaaaatgggcaaaacgactaaatttgacaaagtcgttaaaagagagatttgtcagatc
agtaccaagggaacaagagtctatactgcccaagatgctgaagcttcagccccaacgtct
acgtacttgctgtctatcattgaaaaacaggagcgtaatcaaaatatatcaagttatgga
gtctgtttcattgatacaaccattggagatttcaatcttggtcagtttcaagatgatcgc
tgcaactcgagactattaacgctacttgctcattatcctcccgctcacgttatttatgag
cgtaataatttaagtcaaaccactttaaagattttgaacaacttattacctggtgcaatg
aaagaagccttacagaaagaagttcaattttggtcatccaccaaagttttgaatgttcta
cacgaggctgattactttaaaaacgaagaagattccagtttttcatggccaaaaggttta
gaaccatatttaaatgatggagacagcttaggacttacgcctttggaagaaaagcaatta
gcagttaatgctcttggtggatgtgtgtatttactcaaaaactatcaattggatcatcag
ttattagcgcaaggaaggttcaaaacttacgtaccacccgacttttccgttaatgctgag
aagtcagacggaaccaagttggcttataatatggttttggatgccatgacaataactaat
ttgagagttcttggtaatgaaggatcgttgataaagacattagataattgctgcactgct
ttcggtaaaagattattacgagaatgggtatgcaggccatcttgccgcaaaagcgttatt
gtcgaacgacaaaacgctataactgaattgatagataacccggacgtagttcaggaagtt
cgtagcaagttgagcggattaccggatctcgaaagattgttgagcaaaattcacgtacaa
ggaaatgctgcaaaactacgtaatcatccagatggacgtgctatcatgtttgaaggtccc
gcctactccaagaaaacaatcgttgactttattacagcacttaatggctttgaagatatt
ttaaaattaattaaaaaattttcgaaattcactaatccactcatcaacaagtgtacgcaa
ttggaaccagaaggcgatttcccagagttgcgagaaactttagatcacttcaaaacggcg
ttcaatcacgaagaagccaaaaaggaaggattcatagtacccaaacacggcgtcgacaga
gaatatgacgctgttttgatggaactggctgatattaaaaaagaattagattcttacctt
gagaagcagagaaagcatttcggagtccaaataaagttttgtggaaacgacaaaaagaga
ttccaaatagaagtcccagaaagtcaaattaaaaaagtcggcagcggctacgagttgcag
gggtcaagaaaaggtttcaagaggtattacactgaagaatccaaggatcttcttgcaaga
caaatagctgctgaggagcaaaaggataaagttttgaaagacagtaataggaaaatcttt
gccaaattcagcgaccaatatgacaaatggagcaatgccacctacaatatcgcagttctg
gattgtttgatatctcttgcggaatatgcccgtacatgcgtgacgtgcattcccacaatt
tttgatgatacggatgatcaaggcatattcatcgaaatacgggagggcaaacatccatgc
attgtttccgaaaactttattccgaatgacactgttattgcgaccgccgaagccgctcca
ctcataattttgactgggccgaatatgggaggtaaatcaacactgatgcggcaagttggt
ctcattacaataatggctcaaatcgggtgtcatgtaccagccactgattgcaatttaacc
cttgtcgatcgcatcttcactaggttgggagcgaatgacgatattatggcaggccagagt
acgttcctggtcgagttgagcgagacttctgctatattgcaacacgctacaaagtactct
ttagttttgctggatgaactaggtcgcggtacatcgacttacgatggaactgctattgcc
gcgtctgtggtggaagcccttaccaaaatacagtgcaggacacttttctccactcattat
catactcttgtggaagattacaagatgaataaaaatgttaccctcgcgcatatggcatgc
atggttgaaagtgatgatgaagatcaaataagcgaagagaacgtaacgttcctttacaaa
ttgagcgaaggcgcgtgcccgaaatcttatggtttcaatgctgctagattagctggagta
cctgcaagtatcactaagcgcgctcaaagtattgcgaccaaattagaggctgaagttaat
cttcgacatgcatttactgctctttgtaaaattaccgatagtactgccgtcaaaccgttg
tttcaaaaaggctttgagtttctttcaaagtgttag

DBGET integrated database retrieval system