KEGG   Nasonia vitripennis (jewel wasp): 100115700
Entry
100115700         CDS       T01081                                 
Name
(RefSeq) putative U5 small nuclear ribonucleoprotein 200 kDa helicase
  KO
K12854  pre-mRNA-splicing helicase BRR2 [EC:3.6.4.13]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100115700
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:nvi03041]
    100115700
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100115700
Spliceosome [BR:nvi03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    100115700
 Complex C
   U5 SnRNP specific factors
    100115700
SSDB
Motif
Pfam: Sec63 DEAD Helicase_PWI ResIII Helicase_C AAA_30 AAA_22 AAA_19 HTH_61 DUF2075 UvrD-helicase DnaB_C GEN1_C
Other DBs
NCBI-GeneID: 100115700
NCBI-ProteinID: XP_001599298
NASONIABASE: NV18250
UniProt: A0A7M7G4R7
Position
1
AA seq 2129 aa
MADAAARQLQYEYKANSNLVLQADVRLIERRSRDEATGEVMSLVGKLDGTRMGDRAQRSK
PGKAEERKVKRQKRDEAQYEFTHNKGATVLSDGVDEMVGIVYRPKTQETRQTYEVLLSFI
QEAIDHQPRDILCGTADEVLAVLKNDKLKEKEKKKETELLLGSLADERFALLVNLGKKIT
DFGTDEKTTTGEENIDETYGINVQFEESSEEDDEDVYGEVRENEDEGDEGVEANEDRAIH
AENLGKAEETKKEKPLHPRDIDAYWLQRQLKAIYNDAIVSHGKAKDVLEVLKTSVDCENQ
LVLLLGYDCFDFIKMLKKYRHMIAYCTMLASSQSNSERQKIRKKMSEDPALSKILYQLET
GKGDEGEETIEAREQRHRREEIEDAGGPGGLVPGTRNVIDLEDIAFAQGSHFMPNKRCHL
PDGSFRKQRKGYEEVHVPALKPKPFAENEKLVSINDLPKFAQPAFEGFKTLNRIQSRLYK
CALDEDENLLLCAPTGAGKTNVALLCMMREIGKHINADGTINADDFKIIYIAPMRSLVQE
MVGNFGKRLASYNLTVSELTGDHQLTREQISSTQIIVCTPEKWDVITRKGGEKTFTSLVR
LIIVDEIHLLHDERGPVLESLVARTLRNIETTQEDVRLVGLSATLPNYEDVAAFLRVKPA
TGLYYFDNSFRPVSLEQQYIGVTEKKALKRFQVMNEVVYEKTMEHAGKNQVLIFVHSRKE
TGKTARAIRDMCLEKDSLGQFLREGSASMEVLRTEAEQVKNMELKDLLPYGFAIHHAGMT
RVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYNPEKGRWVELGALDVL
QMLGRAGRPQYDTKGEGILITNHSELQYYLSLLNQQLPIESQLVSKMPDMMNAEIVLGTI
QNVRDAVTWLGYTYLYIRMLRCPTLYGISHDKIRDDPLLELHRADLVHSAAMALDRSGLI
KYDRKSGNFQATELGRIASHYYCTHETISTYNQLLKRTLSEIELFRVFSLSSEFKNINVR
DEEKLELHKLMERVPIPIKENMEEPSAKVNVLLQAYISQLKLEGFALMSDMVYVTQSASR
LMRAIFEIVLFRGWAQLADKCLSLCKMIDRRMWQSMSPLRQFRKMPEEIVKKIEKKNFPW
ERLYDLGPNEIGELIRVPKLGKTVHKYIHQFPKLDLSTHIQPITRSTLRVELTITPDFMW
DDKVHGASEAFWILVEDVDSEVILHHEFFLLKSKYAGDEHLIKFFVPIFEPLPPHYFLRV
VSDRWIGAETQLPVSFRHLILPEKNLPPTELLDLQPLPITALRNSVFENLYVEKFPQFNP
IQTQVFNAVYNSDDNVFVGAPSGSGKTTIAEFAVLRLISQNPDGRCVYMVSKEALAEIIY
SDWAYKFKSLGKKVVLLTGETGTDLKLLAKAQIIITTADKWDVLSRRWKQRKNVQNIQLF
IIDELQLIGGEEGPVLEVACSRARYISSQLDKPTRIVALSASLADAKDVAQWLGAPAAAT
FNFQTSVRPIPLELHVQGINITHNASRLAAMAKPVYNAILRHALRKPAIIFVPTRKQARL
TAFEILTFTAAEGKPTQFFHAEESDIKPFLDRMSDKTLKETLAQGVAYLHEGLSANDRRL
VEQLFDSGAIQIAVCTRDLCWSLSIYAYLVVVMDTQCYNGKTHAYEDYPVTDVLQMVSRA
NRPQEDDDSKCVLLCQSSKKDFFKKFLMEPLPVESHLDHRLHDHFNAEVVTKTIENKQDA
VDYLTWTLLYRRLTQNPNYYGLQGVTHRHLSDHLSELVESTLSDLEQAKCVTVEDEMDVT
PLNLGMIAAYYYINYATVEMFDASLNAKTKIRGLIEIISAAAEYEAIPVRQKEENLLRSL
ASRLPHAPQAQRMADPHIKAQLLLQAHLSRIQLGPELQHDTELVLNKSIRLIQASVDVLS
SAGWLAPAVAAMELAQMVTQAMWSKDSYLKQLPHFTPEIIKRCTDKGVETVFDVMELEDD
VRNRLLQLTEQQMTDVAKFCNRYPNIEMAFDVQDKDRIRLGDTVNVVVQLEREDEVTGPV
VAPLFPQKREEGWWVVIGDPKANQLLSIKRLTLQQKATVKLDFLAPAPGQHHYTLYFMSD
AYLGCDQEYKFSINVGEYMSDASSGSESD
NT seq 6390 nt   +upstreamnt  +downstreamnt
atggcggacgcagcggctaggcagctgcaatacgaatacaaagcgaattctaatcttgta
ttacaagctgatgtgagactcatcgagagacgaagcagagatgaagctacaggagaagtt
atgtccctggtgggcaagctcgatggcacgcgaatgggcgatcgtgctcaacgatcaaaa
cccggaaaggccgaagagagaaaagtcaagcgacaaaaacgtgatgaagcacagtatgag
tttactcataacaagggtgccaccgtcctctccgatggtgtggatgagatggttggcatc
gtatacagacctaaaacacaagagactcggcagacgtatgaagtcttgttaagtttcata
caagaggctattgaccatcaacctcgcgatatactttgtggtactgcagatgaagtatta
gctgttttaaagaatgacaaattaaaagagaaggagaagaaaaaggaaactgaactttta
cttggaagtttagccgatgaacgatttgctctattggtcaatttagggaaaaaaataacg
gattttggtacagatgagaaaacaactacaggcgaggaaaatattgatgagacatatggc
attaatgtccaattcgaggagagcagtgaggaggatgatgaagatgtgtatggagaagtt
agagaaaatgaagatgaaggggacgaaggagtcgaagctaatgaagatagagccattcat
gctgaaaatttaggcaaagcagaagaaacgaaaaaggaaaaacccttacatccaagagac
atcgatgcttattggcttcagagacagttgaaagctatctataatgatgcaattgtctcc
catggaaaagctaaagatgtacttgaggttttaaagacctcagtcgactgtgaaaaccaa
ttagttttattactaggctacgactgctttgacttcatcaagatgcttaaaaaatacaga
catatgattgcatactgtacaatgttggcatcttctcagtcgaacagtgaacgtcaaaaa
attcgcaagaaaatgtctgaagatccagcactttcaaaaatcctttaccaattggaaact
ggtaaaggtgatgaaggtgaggagaccattgaggcaagagagcagcgtcataggcgcgaa
gaaatcgaagatgctggtggtcctggaggattagttccaggaacacgaaacgtaattgac
ttagaggacattgcctttgcgcaaggaagtcacttcatgcctaataaacgttgtcactta
cctgatggaagttttagaaaacaacgtaaaggatacgaagaagtgcatgtaccagcattg
aaaccaaaaccgtttgctgaaaatgaaaaacttgtttccataaacgacttgccgaaattt
gcccagcctgcattcgagggtttcaagacccttaacagaattcaaagtcgtttgtacaag
tgcgctttggacgaagatgaaaatttattattatgtgctccaacaggtgccggtaaaact
aatgtcgctttgttatgtatgatgcgtgagataggcaagcacataaatgctgacggcact
ataaacgccgacgactttaaaattatatacattgcaccaatgcgttctctcgtacaggaa
atggttggtaattttggcaaaagattagcctcatacaacctgacagtgtcagagttaaca
ggcgatcatcaattaaccagagaacaaatctcctctacacagattatagtatgtaccccg
gaaaaatgggatgtcattacgagaaaaggaggagaaaagacctttacctcactcgtaaga
cttatcattgttgatgaaattcatttgcttcacgacgaacgtggtcccgttcttgaatcg
ttggtagcaagaactttaagaaacattgagacgactcaagaagatgtcagactagtaggt
ctgtcagctacacttccgaattacgaagatgtcgccgcattcttacgcgtcaaaccagcg
actggactttattatttcgacaatagttttaggcctgtgtcattagagcagcaatacatc
ggtgttacggaaaagaaggctctaaaacgttttcaggttatgaatgaagtcgtctatgaa
aagacaatggagcatgcgggtaaaaatcaagtgcttatattcgtgcattcgaggaaggaa
accggtaaaaccgctcgtgcaatcagggatatgtgcctggagaaagatagtcttggacag
tttctcagagaaggctcggcatccatggaagttttgagaactgaagccgaacaagttaag
aacatggagttaaaagatctgttgccttatggtttcgcaatccatcacgccggaatgaca
agagtcgatcgtaccttggtagaggatctctttgccgataggcatatccaagttctggta
tctactgcaactcttgcatggggtgtaaatttgccagcgcacactgtcattattaaaggt
acccaagtttataatccagaaaaaggacgttgggtggaattaggagctctggatgtgttg
caaatgctgggtcgtgctggacgtccgcaatatgacaccaaaggagaaggtatactcatt
acgaaccacagtgaactccagtattacctgtcccttttgaatcagcaactccccatcgaa
tctcagctagtcagcaagatgcccgatatgatgaatgcagaaatagtacttggtacaatt
cagaatgttcgcgatgcagtaacgtggctcggttacacatacctctacatcagaatgctt
cgttgtcctactctttacggtatcagccacgacaaaatacgcgatgatcctttgctagag
ttgcaccgtgcagatttagtgcactctgctgccatggctctggaccgcagcggtcttatc
aaatacgatcgcaaatctggtaacttccaagctaccgagcttggtagaattgcttctcat
tactactgtactcatgagactatatctacctacaatcaactattgaagaggacactcagt
gagatcgaactattccgtgtattctcgttgtcaagcgagttcaaaaatattaatgttaga
gatgaagagaaattagaattgcacaaactaatggaacgcgttccgattccaattaaggag
aatatggaggagcctagcgcgaaggtgaatgtactgcttcaagcttacatatctcaacta
aaacttgaaggttttgccctcatgtctgacatggtttatgtcactcaatctgcttcccgt
ttgatgcgcgcaattttcgagattgtattgttccggggctgggctcaattggcagacaaa
tgcctctcgctttgtaaaatgattgatcgtcgtatgtggcaatctatgtcgccgctgcga
cagtttcgcaaaatgcccgaagaaatagtcaagaagattgaaaagaaaaactttccatgg
gagaggttgtacgatcttggaccgaatgaaattggtgaacttatacgtgtgcccaaactt
ggaaagactgtccataaatacattcaccaatttccgaaactggatctttccacacacatt
cagccgattacgagatcaacattgcgcgttgaattaacgattacacctgacttcatgtgg
gacgacaaagttcatggtgcatcggaagccttttggattcttgtggaagatgtcgattct
gaagtgattttgcatcacgaattcttcttgctcaagtctaaatatgccggagacgaacac
ttgataaaattttttgttcccattttcgaaccattacccccgcactacttcttgcgggta
gtatccgatcgatggatcggcgctgaaacacaattgccggtaagtttccggcatttgata
ctcccggagaagaatcttcctccaacagaattattggatttacaaccattgccaatcacg
gctttgagaaactccgttttcgagaatttgtacgtggagaagtttccgcagtttaaccct
atccagactcaggtcttcaacgccgtgtataattccgatgataacgtgttcgttggtgca
ccaagtggctccggaaaaactacaatcgccgaattcgccgttctgcgattgatctctcaa
aatccggatggaagatgcgtttatatggtgtcaaaagaagcgcttgctgaaattatatac
agcgactgggcgtataaatttaaaagtcttgggaaaaaagtcgtgcttttgactggcgag
actggtacagatctgaagcttttggccaaagcacagatcatcattacaaccgccgataaa
tgggacgtcctttcacgaagatggaagcagagaaagaatgtacaaaacattcaattgttc
atcatagatgaactacaactcataggcggcgaggagggaccagttttagaagtagcttgc
tccagagctaggtacatttcgtctcaattggataagccaaccaggattgttgccttatcg
gcatcactggccgatgccaaagatgttgcgcagtggctgggtgctcctgcagctgctact
ttcaatttccaaacatctgtgcgccctatacctcttgaacttcacgttcagggtatcaat
attactcacaacgcatcgcgtttagctgccatggcaaaaccagtgtacaatgcgatcttg
cggcatgcactgagaaagcccgccatcatctttgtaccaacacgaaaacaggcaagattg
acggcatttgagatcttgacctttacagcagcagaaggaaagccgacgcaatttttccac
gccgaagaatcggacatcaaaccatttttagacagaatgtctgataagaccttgaaagaa
actttggctcaaggagtcgcttatttgcacgaaggtttgtcagcaaacgatagaagactt
gtagaacagttattcgatagtggggcaatacaaatcgctgtttgcactcgggatctctgt
tggagtctctcaatctatgcttaccttgtggtagtcatggacacccaatgttacaatggt
aaaacgcacgcctacgaggactatcccgtgacggatgtcttgcaaatggtgtcacgagca
aacagaccacaagaagatgacgattctaaatgcgtactcctttgccagagctcaaagaaa
gactttttcaaaaagtttttgatggaaccgttgccggtggaaagtcatttagatcatcgt
ttacatgaccattttaatgccgaagtggtcacaaagaccattgaaaataaacaggatgcc
gtagattatcttacgtggactctactctacagacgactcacccaaaatccaaattactat
ggactgcagggtgtcactcacaggcatttatctgaccatctttcagaacttgtcgagagc
actctgagtgacttggaacaagccaaatgcgtaactgtagaagatgaaatggacgtcacg
ccattgaatctcggaatgattgcagcatactattacatcaattacgcaaccgttgaaatg
ttcgacgcgtcccttaatgcgaaaactaagattagaggattaatagaaatcatatcagct
gcggctgagtatgaggcgataccagttcgccaaaaggaagaaaatctcctgagaagctta
gcaagcagattgccgcatgctccacaagcacaaagaatggctgatccccacatcaaagct
cagcttttattacaagcacatttatccagaatacagctaggacctgagctacaacacgat
acggagttagtgctgaataaatcgatcaggctgatacaggcctctgtcgatgtcctgagt
tctgcaggttggcttgcacctgcggtagctgctatggaattggctcaaatggtcacacag
gcgatgtggtcaaaggattcatatctcaaacaattgcctcatttcacgcccgaaataata
aaacgttgcacagacaaaggtgtagaaaccgttttcgacgtcatggagctggaggatgat
gtacgcaaccggcttttgcaactaactgagcagcaaatgacggatgttgctaaattttgt
aatcgttatcctaacatcgagatggcattcgatgttcaggacaaagatagaatccgactt
ggagataccgttaatgtcgttgttcaattagaacgcgaggatgaggttacagggcctgtg
gtagcacctcttttcccacagaaaagagaagaaggatggtgggtggttattggtgacccc
aaggccaatcagctcttgtcgatcaagaggttaacattacaacagaaagctaccgtgaaa
cttgactttttggcaccagctcctgggcaacatcactatacgctttacttcatgagtgat
gcatatttgggatgtgatcaagaatataaattctctatcaacgttggagagtatatgtcg
gatgccagctctggatccgagtcggactaa

DBGET integrated database retrieval system