KEGG   Nasonia vitripennis (jewel wasp): 100117522
Entry
100117522         CDS       T01081                                 

Definition
(RefSeq) chromatin-remodeling complex ATPase chain Iswi
  KO
K11654  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 [EC:3.6.4.-]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:nvi03021]
    100117522
   03036 Chromosome and associated proteins [BR:nvi03036]
    100117522
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     100117522
Transcription machinery [BR:nvi03021]
 Eukaryotic type
  RNA polymerase I system
   Other transcription-related factors
    NoRC (nucleolar remodeling complex)
     100117522
Chromosome and associated proteins [BR:nvi03036]
 Eukaryotic type
  Chromatin remodeling factors
   CHRAC complex
    100117522
   RSF complex
    100117522
   WICH complex
    100117522
   B-WICH complex
    100117522
   NuRF complex (fruit fly)
    100117522
SSDB
Motif
Pfam: SNF2_N SLIDE HAND Helicase_C ResIII DEAD DBINO Myb_DNA-binding HDA2-3 DUF4800 GYD
Other DBs
NCBI-GeneID: 100117522
NCBI-ProteinID: XP_031776905
NASONIABASE: NV15374
Position
1
AA seq 1023 aa
MSKAEENASDAGDNSNDSSAETSSSRGGGDFETKLETDRSKRFDFLLKQTEIFSHFMTNN
AKDKTSPLKVKPGRPRKTPAPNEKLQPPEPKESKESKDAKDKDAADHRHSKTEQEEDEEL
LAADSNVVLPITRFENSPPYIKSGELRDYQIRGLNWMISLYENGINGILADEMGLGKTLQ
TISLLGYMKHFRNINGPHIVVVPKTTLANWMNEFKKWCPSLRTVFLIGDSDTRNAFIRDV
MLPGEWDVCVTSYEMVLREKWVFKKFNWRYMVVDEAHRLKNEKSKLSEILRECKTANRLL
LTGTPLQNNLHELWSLLNFLLPDVFNSSEDFDSWFNTNSFLGDNTLIERLHAVLRPFLLR
RLKSEVEKALKPKKEIKVYIGLSKMQREWYTKVLMKDIDIVNGAGKIEKMRLQNILMQLR
KCCNHPYLFDGAEPGPPYTTDEHLVYNCGKLVILDKLLPKLQQQQSRVLIFSQMTRMLDI
LEDYCHWRCYQYCRLDGNTAHEDRQRQINEYNAPGSEKFIFMLSTRAGGLGINLATADVV
IIYDSDWNPQMDLQAMDRAHRIGQQKQVRVFRFITENTVEEKIVERAEVKLRLDKLVIQQ
GRLIDAKQNALNKDEMLNIIRHGANEVFASKDSAITDEDIDTILQKGEEKTQEMKQKLES
LGESSLRNFTVDAPTDSVYQFEGQDYREKQKILGIGHWIEPPKRERKANYAVDAYFREAL
RVSEPKAPKAPRPPKQPIVQDFQFFPPRLFELLDQEIYYFRQTVGYKVPKNPELGSDAAR
IQKEEQRKIDDAQPLTDEEVAEKEKLLTQGFTNWTKRDFNQFIKANEKYGRDDIENIAKE
VEGKTPEEVMEYSAVFWERCHELQDIDRVMAQIERGEAKIQRRAGIKKALDAKMARYRAP
FHQLRIAYGTNKGKNYTEEEDRFLVCMLHKLGFDKENVYEELRATVRSAPQFRFDWFVKS
RTALELQRRCNTLITLIERENQELEERERQERKKKGGGNTSTKPTSKRKVESLPAPQPRK
KKK
NT seq 3072 nt   +upstreamnt  +downstreamnt
atgtcgaaggcggaggagaacgcgagcgacgccggcgataattctaatgactcgtcggcg
gagacttcctcgtcgcgaggcggcggcgacttcgagacgaagctcgagaccgaccgcagc
aagcgtttcgatttcctgctcaagcagaccgagatcttctctcacttcatgaccaacaat
gccaaggataagaccagtccgctaaaggtcaagcccggcaggcccaggaagacacccgcg
cccaacgagaagctccagccacccgagcccaaggaatccaaggagtccaaagacgccaag
gacaaggatgctgcggatcacagacacagcaagaccgagcaggaggaggacgaggagctg
cttgctgctgactccaatgttgtcttgcctattaccaggtttgaaaactctccgccgtac
atcaagtctggagagctcagggactaccagatcagaggactcaactggatgatttcgctc
tacgagaatggaatcaacggtatcttggcagatgagatgggtttaggaaaaacattgcaa
accatttcacttcttggttacatgaagcattttagaaatataaatggacctcacattgtt
gttgttcctaaaacaacattggctaattggatgaatgaattcaagaagtggtgtcctagt
ttaagaacagtttttcttatcggtgactcagataccagaaatgccttcattagggatgta
atgttgccaggagagtgggacgtatgtgttacatcttacgaaatggtactcagggaaaaa
tgggtattcaagaagttcaactggcgttatatggtggttgatgaagctcacagattgaaa
aatgaaaaatctaagctctccgaaattttacgagagtgcaagacagccaacaggcttttg
ttgactggtactccgcttcagaacaacttgcacgagttgtggtcgctgttgaatttccta
ctacctgacgtcttcaatagctctgaagattttgattcttggttcaacacaaacagtttc
ttgggagataatactctcattgaaagactgcacgctgtacttcgtccattcttgctgcgt
aggttgaagtctgaagtagagaaggcactgaagccaaaaaaagaaattaaagtctatata
ggtttgagcaaaatgcagcgcgaatggtatacaaaagttctcatgaaagacatcgacatt
gtaaacggtgctggtaagattgagaagatgcgacttcagaacatcctcatgcagctacgt
aaatgctgtaatcacccatacttgttcgatggcgccgaacctggaccaccttacactacc
gatgagcatctcgtctacaactgcggcaaactggttatcctcgacaaattgctaccgaaa
cttcagcagcagcaatctcgtgtacttattttcagtcagatgacgcgtatgctggacatt
ttggaagattactgccattggcgttgctatcaatactgccgtttggacggtaacacagct
cacgaagatcgtcaaagacagatcaacgagtacaatgcaccaggaagtgagaagttcatt
tttatgttgtctactcgcgctggtggcttgggtatcaatttggcaactgccgacgtcgtc
atcatttacgactctgactggaatcctcagatggatcttcaggctatggatcgtgctcat
cgtattggtcagcaaaagcaggtgcgcgtcttccgtttcatcaccgagaacacagtagaa
gaaaaaatcgtcgagcgtgctgaagtaaaacttcgactggacaagctcgttatccaacaa
ggtcgtctaatcgatgcaaaacaaaacgctctcaacaaggacgaaatgctgaacatcatt
cgtcacggtgcgaatgaagtattcgcttctaaggatagtgctatcactgacgaagacatc
gatactatcctccaaaagggcgaggagaagactcaggagatgaagcagaaactcgaaagc
cttggagaatcctcccttcgtaatttcactgttgacgctcctaccgactctgtctatcag
tttgagggtcaggattacagagagaagcagaaaatcttgggtattggccattggatcgaa
ccaccaaaacgtgagcgtaaagcaaattatgccgtagatgcctacttccgagaggcactg
cgtgtatcagagcctaaagcgcccaaggctcctagaccacctaaacagccaattgtgcaa
gacttccagttcttcccgcctaggctttttgagcttcttgatcaggagatttactacttc
agacaaacagttggttataaggtgccaaagaatcctgaattaggctccgatgctgctaga
atacaaaaggaagagcaacgtaagatcgacgatgctcaaccacttactgacgaagaggtt
gccgaaaaagagaagctactcactcagggtttcaccaattggaccaaacgtgactttaat
caatttataaaagcaaacgaaaaatacggtagagatgacatcgagaatatcgccaaagaa
gtcgagggtaaaacacctgaagaggtcatggaatattccgctgttttctgggagcgctgc
cacgagctccaagacatcgaccgtgtgatggctcaaattgaacgaggtgaggcaaaaatt
cagcgtcgagccggtatcaagaaagctttggatgccaaaatggcgaggtaccgtgcacca
ttccatcaactgaggatagcttatggtactaacaagggcaagaactatacagaggaggaa
gaccgattccttgtatgcatgcttcacaaattaggttttgacaaagagaacgtgtacgaa
gagttaagggcgacggtgagatctgcaccacagttccgttttgactggttcgtaaaatca
cgtacagccttggaactccagcgaagatgtaatacactgattacgttgatcgaaagggag
aaccaagaattagaggaacgagagaggcaagaaagaaaaaagaagggtggtggaaacacg
agtacgaagccgacgtcgaaacgtaaggttgaaagtctgccggctccccagcccagaaag
aaaaagaagtag

DBGET integrated database retrieval system