KEGG   Nasonia vitripennis (jewel wasp): 100119232
Entry
100119232         CDS       T01081                                 
Name
(RefSeq) low-density lipoprotein receptor-related protein 6
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04150  mTOR signaling pathway
nvi04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100119232
   04150 mTOR signaling pathway
    100119232
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nvi04131]
    100119232
Membrane trafficking [BR:nvi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    100119232
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a SGL DUF5050 cEGF
Other DBs
NCBI-GeneID: 100119232
NCBI-ProteinID: XP_031783773
NASONIABASE: NV14309
Position
3
AA seq 1638 aa
MARFQAFLLGTACLLCCFAADLTHGSPRLLFATNKDIRVANVSRANKLVGTIVKELPEGT
TLDFYYERNLVCWSNNAIETIQCVRSNGSYTHEPITVVNSSLISPDGLACDWYTGKLYWT
DGEKNRIEVTSIEGSIRKVLFWTEIYQPRAIALVPQASIFFWTDWGELPKIERAAMNGDP
STRSVLVSEDIFWPNGLTVDYDNELVYWVDGRYKFIAVMDYNGRNRRKILTEGLEYPFAI
SYFDQRLYWTDWRTWCIHSLELSRNAAGVQQKPRELLHGEYIPGDIEVWEPSRQPPPKPG
ANPCGVNNANCSHLCLLSTKPPGYSCACPTGVKLLEDRHSCASGPQELLLIVQRNEISTI
SLDSPDYTNFVLPLQGIKHAIAIDWDPIDEMLYWTDEQAHVIRRAYLNGSGQQDILTTEI
KSADGIAVDWIARNLYWTDTGIDRIQVSRLDGSYRKVLIHEDLGEPRAISLGLELGWMFW
TDWDEKRPKIERSNLDGTERTIIVSKDITWPNGIALDLERKKVYWCDAKTDKIEVCNMDG
SERREVITDNLPHLFGFSLLGDFLYWTDWQRRSIDRAHKLTGDQREIIVEQFANVMGLKA
VHRGKPNGTNPCAHANGGCTQLCLNRPQNKYVCACQIGYELANDMRTCLVPESFLLFTRK
DKIGRTSIENANNDNIIPITGIKDASALDFDLADNRIYWTDVKLKIIIRAFMNGSEVEKV
VDLGLETPDGLAVDWIAHNLYWSDTGTRRIELIHLNGYSRRVIIWQNLIEPRCLALDPER
GFIYWTEWANTGSIERAWLDGTDRQVIISGIGRTNGLTIDHAAHRLYWADLFTPAIDSYD
LTTGKRKEIITQKIGYPFSITQYQDYIYWTDWNTGDIERANKTTGGNRTEIHDNLESVTD
LLVVHKSRQPGWNTCAINNGECSHLCIALPGSTGGLSTNHKCACPTHYTLSADNRTCLGP
KNFMVYSYRNVMGRFLPDSNHDCPDTSLRVQGLKNVRAIEFDPITQYIYWIRTGDGRSSS
IRKALENRTHAVLVLPGGSGHPFDLALDPLGRLLFWSCSQNDAINVTRLDSDSSLGVVVK
GEGEKPRNIAVHPEKRLLFWTDVGEKMRVMQSLMDGKERIVIASDLESPSSLAVDTAANL
IFWAHGRQIEYAEIGGGNRRVLIAGLQGSVLHLSVLFEYLYWFDRDSQIVERVEKRSGAS
RKTMMSNRPLTDLVSVHTPSDLAMEDNLCSPLHEYGGCSHICLGSRCSCPQSLVLADDGK
NCRVAPSCGPEHFTCLTSKSTDSKDCIPGSWKCDGQRDCADGSDELGCPPCNRELYFECH
NGQCIENAWVCDGRRQCSAGEDEVNCCRAGQFRCVSSGVCIPATALCDGWENCADGSDES
APACASVNNHRQAAEPTLESGKSTYVVSVLLVIAGTGFAILGFYYCRRRLAANAAGGAGA
GSEELPDILHDSAGDPLSPKSCRTAKPMLNSYKNGRKEQLKPGMAVRMSTLNGSSISSSY
DRSHITGFSYCASSSTHDSSAGGYPQETLNPPPSPATTANSTRCSSSNASRYRPYRNYRS
INQPPPPTPCSTDVCDESDSNYPAMPRFRYGHAGEPFPPPPTPRSVYQSDTAISCPPSPS
SRSSTYFSPLPPPPSPVP
NT seq 4917 nt   +upstreamnt  +downstreamnt
atggcgagatttcaagccttcctcctcggcaccgcctgtctgctctgctgtttcgccgcc
gatctaactcatggctcgccgaggctgctgttcgcgacgaacaaggacatccgggtggcg
aacgtctcgcgggccaacaagctcgtggggacgatagttaaggagctgccggagggcacg
actctggacttctattacgagcggaatctggtctgctggagcaacaacgccatcgagacc
atccagtgcgtgcggagcaatggcagctacactcacgagcccatcaccgtcgtcaactcg
agcctcatctcaccggatggtctcgcctgtgactggtacaccggcaagctctactggacc
gacggcgagaagaacaggatcgaggtgaccagcatcgagggtagcatacgcaaggttctc
ttctggacggagatctatcagcccagggcgatcgccctcgtgccgcaggcgagcatattc
ttctggaccgactggggagagctgccgaagatcgagcgagccgccatgaacggagatccc
tccacgaggagcgtactcgtgtccgaggacatattctggccgaacgggctcacggtcgac
tacgacaacgagctggtttactgggtcgacggtcgttacaagttcatcgctgtcatggat
tacaacggcaggaacagacgcaagatactgaccgagggcctcgagtatccctttgccatc
agttacttcgaccagcggctctactggaccgactggcgaacctggtgcatacacagcctc
gaactctcccgcaatgccgctggcgtccagcagaagcctcgggagttgttgcacggcgag
tacatacccggcgacatcgaggtctgggagccgagcagacagccaccgccgaaacccggt
gccaatccctgcggcgtcaacaacgccaactgttcgcacctctgtctgctgagcaccaag
ccaccgggctacagttgcgcctgtcccaccggagtcaagctcttggaggatcgacacagt
tgcgcgtcgggcccccaggagctcctgctcatcgtgcagcgcaacgagatcagcaccatc
agcctcgattcccccgactacaccaactttgtcttgccgctccagggtatcaaacacgcg
atcgccatcgactgggatcccatcgacgagatgctctactggaccgacgagcaggcgcac
gtcattcgtagagcctacctgaacggttcgggtcagcaggacatcctcacgaccgagatc
aaaagcgccgatggtatcgcagtggattggatcgcgcgaaatttgtactggaccgatact
ggcatagatcgaattcaggtgtctcgacttgatgggtcttaccgcaaggtcctcatccac
gaggatttgggtgagccgcgagccatatctcttggcctggagctcggctggatgttctgg
accgactgggatgaaaaacggccgaagatcgagcgcagcaatctggacggaactgaacga
accatcatcgtgagtaaggacattacctggcccaacggaatagccttggatctggagcga
aagaaggtttactggtgcgacgcaaagaccgacaagatcgaggtctgtaacatggacggc
agcgagcgtcgcgaggtcatcaccgacaacttgcctcatctctttgggttcagtctgctc
ggcgatttcctctattggactgactggcagaggcgcagcatcgaccgggctcacaagctc
accggagatcaacgcgaaatcatcgtcgaacagtttgccaacgtcatgggcctcaaggcc
gttcatcgggggaagccaaacggtaccaacccttgtgctcatgccaacggcggctgcacc
cagttgtgcctcaatcgaccacagaacaagtacgtttgcgcctgtcagatcggctacgaa
ctcgccaacgatatgaggacttgcctcgtacccgagtcctttttgctattcacgagaaaa
gacaagattggcaggaccagcatcgagaatgccaataacgacaacatcattcccatcact
ggcatcaaggacgcaagtgctctagatttcgatttggccgacaatcgcatatactggaca
gacgtcaaactgaaaatcataatacgtgcctttatgaatggatcggaggttgaaaaagta
gtggatcttggcctagagacgcctgacggtttagcggttgattggatcgcgcacaattta
tattggagtgacacgggtacacgccgaatcgaacttatccatctcaacggttacagcagg
agagttatcatttggcaaaatctcattgaaccccgatgcctcgctcttgatccggaaaga
ggtttcatctactggacggaatgggcaaacaccggtagcattgaacgagcttggttggat
ggcaccgaccgtcaagttattatatctggcattggtcgtacgaatggattaacgatagat
cacgcagcgcatcgactttactgggctgacctgtttacaccagctatcgacagttacgat
ttgacgacgggaaaacgcaaggaaatcatcacccaaaaaatcggttatccattcagtatt
acccagtatcaagattacatttactggacagactggaataccggcgacatcgaacgggcc
aacaagacgactggtggtaaccgaacggagattcacgataacttagaatctgtcacggac
ttgttggtagttcacaagtccaggcaacctggctggaacacgtgcgccattaacaacgga
gaatgtagtcatctgtgcatagctttgcctggttctaccggcggactatcgacaaatcac
aaatgcgcctgccctacgcattacactctttctgccgataacagaacttgtctggggcca
aaaaacttcatggtgtatagctaccgcaacgtgatgggcagatttttacctgatagcaac
cacgactgtcctgacacgtctctgcgtgtacagggtttgaagaacgtgcgagcaatcgag
ttcgatccgataacccagtacatttactggattcgcactggtgacgggcgcagttcctcg
attcgaaaagctttggaaaatcggacgcatgcggttctcgtcttacctggtggtagcggt
caccccttcgacctggcactcgatcccctcggtcgactgcttttctggtcttgctcgcag
aacgacgccatcaacgttaccaggcttgatagtgattcgagcctgggtgtagttgttaag
ggcgagggtgaaaagcctagaaatatcgcagtgcatccggaaaagaggctgctcttctgg
acagatgtgggagaaaaaatgcgtgtcatgcagagtctgatggatggcaaggagaggatt
gtcatagcctcagatcttgagtcgccgtcgagtctcgcagtcgataccgctgcaaacctc
atcttctgggctcatggtcgacaaatcgaatacgctgagatcggtggtggtaaccggcgc
gttcttattgctgggctgcaaggctctgttcttcatctctctgtactcttcgagtatctc
tactggtttgatcgtgacagccagatagtagagagggtcgaaaaacgatcgggcgctagc
agaaagacgatgatgagcaaccgaccactgactgatctggtatcggtgcacacgcctagc
gacctcgcaatggaggacaatctttgtagccctttgcacgagtacggtggctgttcacac
atttgtctcggctctcggtgctcctgtccccaatcacttgttctcgcggacgacggaaag
aactgccgagtggcaccaagctgtggccccgaacatttcacctgtctcacctccaaatcg
acagattccaaggactgtatacctggtagttggaagtgcgatggccaacgtgactgtgca
gacggtagcgatgaactcggctgtcctccgtgcaatcgagaactctatttcgagtgtcac
aatggtcaatgcatcgaaaatgcatgggtctgcgacggtaggagacagtgcagcgctggc
gaggacgaggtcaattgctgtcgcgccggacagtttcgctgcgtgagctctggcgtatgt
atccccgcgacggcgctctgcgatggttgggaaaattgtgctgatggcagtgacgagtct
gcgcccgcctgcgcgtcggtcaacaatcaccgacaagcagctgaacctaccctcgaatct
ggcaaaagcacctacgttgtttccgtgcttcttgtcatagccggcaccggttttgccatt
cttggcttctactattgtcgacgacgactcgcggctaatgcagcaggaggtgctggcgct
ggtagcgaagagttaccagacattctgcacgattcggccggcgatccactttctcccaag
agctgcaggacagctaaaccgatgctaaacagctataaaaacggcaggaaggagcaactc
aagccaggcatggcagtcaggatgtctaccctcaatggcagtagtataagctccagttac
gaccgcagtcacataacaggtttttcctactgcgcatcgagttcaacccatgatagctcg
gctgggggctatcctcaagagaccctcaacccgccgccgagtcctgcgaccactgccaat
tccacgcgttgttccagtagtaacgcttcgcggtacaggccttaccgaaactatcggagc
attaaccagccacccccgccaacgccttgcagcaccgacgtttgcgacgaatccgacagc
aactacccggctatgccgcgcttcaggtacggtcatgccggggagccctttccgccacca
ccgaccccgaggtcggtataccaaagcgacacggccatcagctgcccgccctcgccgagt
tcgaggtcctcgacctacttcagtcccttaccgccgcctccatcgcctgtaccttga

DBGET integrated database retrieval system